De Verkoop van de de Huidzorg van de het levensuitbreiding

Het Tijdschrift van de het levensuitbreiding

Het Tijdschrift Januari 2013 van de het levensuitbreiding
Op de Dekking  

Verkrijgt u de Juiste Enzymen?

Door Jeffrey Stout

Epidemie van Spijsverteringsongemakken

Als u zich bereikend voor drugs zoals alka-Seltzer ®of pepto-Bismol ®vindt om chronische spijsverteringsproblemen te verlichten, kon u grotere gezondheidsproblemen hebben dan u realiseren. Die OTC-drugs zouden uw symptomen tijdelijk kunnen verlichten, maar zij doen absoluut niets de onderliggende oorzaak van het probleem richten. Als die onderliggende oorzaak ongecontroleerd gaat, zou u voor een gastheer van gezondheidskwesties kunnen opzetten die verwoestend zijn dan gas of opzwellen zoals voedselonverdraagzaamheid en ondervoeding (in oudere volwassenen).

Optimale Enzymformulering die Snelle Zetmeelanalyse vermijdt
Optimale Enzymformulering die Snelle Zetmeelanalyse vermijdt
INGREDIËNT DOEL
Eiwit-verteert Enzymen  
Complexe protease Splitst gehele proteïnen en kleinere peptides in enige aminozuren op.
Trypsine Splitst gehele proteïnen in kortere oligopeptides op die verder tot aminozuren door andere proteasen worden verminderd.
Chymotrypsin Splitst gehele proteïnen en kortere oligopeptides op.
Vet-verteert Enzymen  
Complexe lipase Splitst complexe vetten in eenvoudige vrije vetzuren op.
Vezel-verterende Enzymen  
Cellulase Splitst cellulose, een normaal onverteerbare installatievezel op.
Hemicellulase Splitst hemicellulose, een structurele (en onverteerbare) component van op installatiecelwanden.
Phytase Splitst phytic zuur, korrel en een zaad-afgeleidde suiker op die een onverteerbare vorm van fosfor bevatten, vrijgevend fosfor voor biologisch gebruik.
Bèta-Glucanase Splitst anders onverteerbare vezels met inbegrip van cellulose op.
Pectinase Splitst pectine op, de gelatine-achtige matrijs die in installatiecelwanden, sap en voedingsmiddelen vrijgeven.
Xylanase De hulp splitst hemicellulose in xylose op, een eenvoudige suiker die helpt intestinale bacteriën voeden.

Voorbeeld van een enzymformulering die optimale spijsvertering van proteïnen, vetten, en cellulose verstrekt (installatievezel). Neem nota van de afwezigheid van amylase, de enzymcategorie die dieetzetmeel in bloed suiker-opvoerend eenvoudige suikers opsplitst.

 

De drugs zoals Prilosec® en Prevacid® onderdrukken maag dit zure afscheiding, maar doen ten koste van slechtere spijsvertering. Zelfs wanneer de maag zure productie wordt geblokkeerd, kunnen de maagdieinhoud en de gal door de lever wordt afgescheiden nog terug in de slokdarm terugvloeien en het zuur en irritatie veroorzaken die tot ernstige ziekte leiden. Zij die aan esophageal terugvloeiing lijden willen onverteerd voedsel die in de maag geen langer blijven dan het moet.

De juiste enzymformule vergemakkelijkt snellere spijsvertering die kan helpen gemeenschappelijke spijsverteringsongemakken oplossen.

Hoe het Zetmeel en de Vezel verschillen en waarom het aan u van belang is

De aard veroorzaakt twee belangrijke soorten lange-keten molecules (polysacchariden) uit eenvoudige suikers.41 deze molecules zijn identiek behalve de manier de eenvoudige suikers verbonden zijn.

In complexe koolhydraten (zetmeel), zijn de eenvoudige suikers verbonden samen met een band geëtiketteerd „alpha-“.41 de mensen bezitten spijsverteringsenzymen (meestal amylases) geschikt om deze alpha- band te breken en hopen van vrije glucose vrij te geven.42 die vrije glucose is de oorzaak van het veroorzaken van de na-maaltijdschommeling in bloedsuiker die zo schadelijk gekend om aan gezondheid is te zijn.

Maar de polysacchariden met een zogenaamde „bèta“ band tussen de suikers zijn volledig onaangetast door menselijke spijsverteringsenzymen.41 de bètapolysacchariden in entrepot (collectief genoemd cellulose) zijn veel stijver dan dieetkoolhydraten; zij maken omhoog de meeste structurele delen van installaties zoals bladeren en stammen, met inbegrip van de meeste kruisbloemige groenten.

Het zetmeel wordt opgesplitst in suikers in de dunne darm en dan geabsorbeerd, maar de cellulose is niet.41,42 wanneer de cellulosevezels uw dikke darm bereiken, zijn zij onderworpen aan spijsvertering door micro-organismen daar levend. Die bacteriën hebben enzymen geschikt om cellulose op te splitsen, en zij doen dit krachtig; het vergisten van het om kleiner molecules en gas vrij te geven.43 en dat veroorzaakt het opzwellen, flatulentie, en andere ongemakkelijke symptomen dat een maaltijdrijken in onverteerbare installatievezels zoals broccoli kunnen volgen.

De truc wanneer het aanvullen met spijsverteringsenzymen, toen, moet enzymen omvatten die gedeeltelijk onverteerbare cellulose opsplitsen, terwijl het vermijden van enzymen die spijsvertering van dieetkoolhydraten verhaasten om eenvoudige suikers vrij te geven die uw gezondheid bedreigen. Voor die individuen voor wie de aren van de bloedsuiker een factor zijn van het gezondheidsrisico, vermijd supplementen bevattend amylase of oligosaccharidases. Doel in plaats daarvan voor supplementen die nuttige vezel-verterende enzymen met inbegrip van cellulase , hemicellulase, phytase, bèta-glucanase, pectinase, en xylanase bevatten. Deze enzymen kunnen comfortabelere spijsvertering bevorderen zonder u aan een gevaarlijke schommeling van de na-maaltijd glucose bloot te stellen.

Samenvatting

De geleidelijke verslechtering van spijsverteringsfunctie moet geen onvermijdelijk deel zijn van het verouderen. De juiste combinatie enzymen kan ongemakkelijk verwarren, en nu en dan gevaarlijke gevolgen van onvolledige voedselspijsvertering verlichten.

De spijsverteringsenzymsupplementen bevorderen volledige spijsvertering van voedsel in de maag en de hogere dunne darm. Dat verhindert onverteerd voedsel de dubbelpunt te bereiken, waar de normale bacteriën het vergisten om gas, vloeistof, en de onplezierige symptomen van een slecht-geregelde spijsvertering te veroorzaken.

Het belangrijkste probleem met de meeste spijsverteringsenzymsupplementen is dat zij de analyse van zetmeel in eenvoudige suikers vergemakkelijken die snel als glucose in de bloedsomloop worden geabsorbeerd. Wegens zijn wijdverspreide schadelijke gevolgen voor gezondheid, is de bovenmatige glucose een belangrijke doodsoorzaak onbekwaamheid en in moderne samenlevingen.10-18

Zelfs als één geen koolhydraten dat verbruikte, zou het lichaam nog overvloed van glucose hebben omdat de lever efficiënt proteïne (en vetzuren) in glucose door een proces als gluconeogenesis wordt bekend omzet.

Het is veel logischer om een spijsverteringsdie enzymsupplement met protease en lipase wordt geladen , en gespecialiseerde cellulase te nemen. Die manier, één vergemakkelijkt spijsvertering van essentiële aminozuren, installaties, en in vet oplosbare voedingsmiddelen zonder gevaarlijke glucose aren te creëren.

Als u om het even welke vragen over de wetenschappelijke inhoud van dit artikel hebt, te roepen gelieve een de Gezondheidsadviseurvan de het Levens uitbreiding ® bij 1-866-864-3027.

Verwijzingen

1. Greenberg AANGAANDE, Holt PR. Invloed van het verouderen op alvleesklier- spijsverteringsenzymen. Dig Dis Sci. 1986 Sep; 31(9): 970-7.

2. Miyasaka K, Kitani K. Aging schaadt alvleesklier- reactie op het refeeding na een eiwitvrij dieet. Alvleesklier. 1989;4(3): 346-52.

3. Wolfson D, Olmstead S, Meiss D, Ralston J. Making Sense van Spijsverteringsenzymen: ProThera, Inc.; 2008.

4. Open plek MJ, Kendra D, Kaminski MV, het Jr.-Verbetering in eiwitgebruik in ver*zorgen-huispatiënten bij buis voeden aangevuld die met een enzymproduct uit Aspergillus niger wordt afgeleid en bromelain. Voeding. 2001 April; 17(4): 348-50.

5. Karani S, Kataria-lidstaten, Kapper VE. Een dubbelblinde klinische proef met een spijsverteringsenzymproduct. Br J Clin Pract. 1971 Augustus; 25(8): 375-7.

6. Wooldridge JL, Heubi JE, amaro-Galvez R, ET AL. Eur-1008 is de alvleesklier- enzymvervanging veilig en efficiënt in patiënten met blaasbindweefselvermeerdering en alvleesklier- ontoereikendheid. J Cyste Fibros. 2009 Dec; 8(6): 405-17. Epub 2009 15 Augustus.

7. Hamer HF. Alvleesklier- exocrineontoereikendheid: kenmerkende evaluatie en vervangingstherapie met alvleesklier- enzymen. Dig Dis. 2010; 28(2): 339-43. Epub 2010 1 Sep.

8. Beschikbaar bij: betreden http://chemistry-today.teknoscienze.com/pdf/MU%20OMEGA3- 08.pdf 1 Oktober, 2012.

9. Beschikbaar bij: betreden http://www.us.elsevierhealth.com/media/us/samplechapters/9781437709599/Sample-Chapter-04.pdf 1 Oktober, 2012.

10. Beschikbaar bij: http://docnews.diabetesjournals.org/content/2/8/1.2.full. Betreden 1 Oktober, 2012.

11. Stattin P, Bjor O, Ferrari P, Lukanova A, et al. Prospectieve studie van hyperglycemie en kankerrisico. Diabeteszorg. 2007 breng in de war; 30(3): 561-7.

12. Vigneri P, Frasca F, Sciacca L, Pandini G, Vigneri R. Diabetes en kanker. Kanker van Encocrrelat. 2009 Dec; 16(4): 1103-23.

13. Dreun, LD, Selvin E, Steffes M, Coresh J, Astor BC. Slechte glycemic controle in diabetes en het risico van inherente nierziekte zelfs bij gebrek aan albuminurie en retinopathy: atheroscleroserisico de studie in van gemeenschappen (ARIC). Med van de boogintern. 2008 8 Dec; 168(22): 2440-7.

14. Gehouden C, Gerstein HC, Zhao F, et al. Het vasten de plasmaglucose is een onafhankelijke voorspeller van ziekenhuisopname voor congestiehartverlamming in zeer riskante patiënten. Amerikaanse Hartvereniging 2006 Wetenschappelijke Zittingen. 13 november, 2006. Samenvatting 2562.

15. Healy L, Howard J, Ryan A, et al. Het metabolische syndroom en leptin worden geassocieerd met ongunstige pathologische eigenschappen in mannelijke colorectal kankerpatiënten. Colorectal Dis. 2011 20 Januari.

16. Park HJ, Jung UJ, Cho SJ, Jung HK, Wig S, Choi-lidstaten. Het uittreksel van de citrus unshiuschil verbetert hyperglycemie en leversteatosis door ontsteking en leverglucose te veranderen en enzymen in db/db-muizen lipide-te regelen. J Nutr Biochemie. 2012 Jun 11. [Epub voor druk]

17. Malik VERSUS, FB van HU. Zoetmiddelen en risico van zwaarlijvigheid en Type - diabetes 2: De rol van suiker-gezoete dranken. Rep van Currdiab. 2012 31 Januari. [Epub voor druk]

18. Coutinho M, Gerstein H, Poque J, Wang Y, Yusuf S. The-verhouding tussen glucose en inherente cardiovasculaire gebeurtenissen: een metaregressionanalyse van gepubliceerde gegevens van 20 studies van 95.783 individuen volgde 12.4 jaar. Diabeteszorg. 1999 Februari; 22(2): 233-40.

19. Dominguez-Muñoz JE. Alvleesklier- exocrineontoereikendheid: diagnose en behandeling. J Gastroenterol Hepatol. 2011 breng in de war; 26 supplement-2:12 - 6.

20. Udani J, Sterk M, Madsen gelijkstroom. Het blokkeren koolhydraatabsorptie en gewichtsverlies: een klinische proef gebruikende Fase 2 uittreksel van de merk het merkgebonden opgedeelde witte boon. Altern Med Rev. 2004 breng in de war; 9(1): 63-9.

21. Bergert FW, Conrad D, Ehrenthal K, et al. Pharmacotherapy richtlijnen voor de bejaarden door huisartsen voor het gebruik van huisartsen: De Basisvoorwaarden van deeld ondersteunend drugbehandeling. Int. J Clin Pharmacol Ther. 2009 Mei; 47(5): 289-302.

22. Evans WJ. Oefening en voedingsbehoeften van bejaarde mensen: gevolgen voor spier en been. Gerodontology. 1998;15(1):15-24.

23. Ritz P. Factors die energie en macronutrient vereisten in bejaarde mensen beïnvloeden. Volksgezondheid Nutr. 2001 April; 4 (2B): 561-8.

24. Remond D, Machebeuf M, Yven C, et al. Geheel lichaams het eiwitmetabolisme na de maaltijd na een vleesmaaltijd wordt beïnvloed door het kauwen efficiency bij bejaarde onderwerpen. Am J Clin Nutr. 2007 Mei; 85(5): 1286-92.

25. Evans KE, Leeds JS, Morley S, Schuurmachines DS. Alvleesklier- ontoereikendheid in volwassen ziekte van de buikholte: vereisen de patiënten enzymaanvulling op lange termijn? Dig Dis Sci. 2010 Oct; 55(10): 2999-3004.

26. Dominguez-Munoz JE. De alvleesklier- therapie van de enzymvervanging voor alvleesklier- exocrineontoereikendheid: wanneer wordt het, wat is het doel en vermeld hoe te om het te doen? Adv Med Sci. 2011;56(1):1-5.

27. Roxas M. De rol van enzymaanvulling in spijsverteringswanorde. Altern Med Rev. 2008 Dec; 13(4): 307-14.

28. Eun JS, Beauchemin-Ka. Gevolgen van een proteolytic voerenzym bij opname, spijsvertering, ruminal gisting, en de melkproductie. J Zuivelsc.i. 2005 Jun; 88(6): 2140-53.

29. Fiocchi A, Restani P, Riva E, et al. Vleesallergie: II--Gevolgen van voedselverwerking en enzymatische spijsvertering voor allergenicity van runder en schapenvlees. J Am Coll Nutr. 1995 Jun; 14(3): 245-50.

30. Fuhrmann G, Leroux JC. Fluorescentieweergave in vivo van exogene enzymactiviteit in het maagdarmkanaal. Sc.i de V.S. van Proc Natl Acad. 2011 31 Mei; 108(22): 9032-7. Epub 2011 16 Mei.

31. Shattock P, Whiteley P. Biochemical aspecten in de wanorde van het autismespectrum: het bijwerken van de opioid-bovenmatige theorie en het bieden van nieuwe kansen voor biomedische interventie. De deskundige Doelstellingen van Opin Ther. 2002 April; 6(2): 175-83.

32. Dangin M, Boirie Y, Garcia-Rodenas C, et al. Het spijsverteringstarief van proteïne is een onafhankelijke regelende factor van eiwitbehoud na de maaltijd. Am J Physiol Endocrinol Metab. 2001 Februari; 280(2): E340-8.

33. Dangin M, Boirie Y, Guillet C, Beaufrere B. Influence van het eiwitspijsverteringstarief op eiwitomzet bij jonge en bejaarde onderwerpen. J Nutr. 2002 Oct; 132(10): 3228S-33S.

34. Koopman R, Crombach N, Gijsen-AP, et al. De opname van eiwithydrolysate gaat van een versneld spijsvertering en absorptietarief vergezeld in vivo wanneer vergeleken met zijn intacte proteïne. Am J Clin Nutr. 2009 Juli; 90(1): 106-15.

35. Oben J, Kothari-Sc, Anderson ml. Een open etiketstudie om de gevolgen te bepalen van een mondeling proteolytic enzymsysteem voor weiproteïne concentreert metabolisme in gezonde mannetjes. J Int. de Sporten Nutr van Soc. 2008;5:10.

36. Omogbenigun FO, Nyachoti cm, Slominski-BEDELAARS. De dieetaanvulling met multienzymevoorbereidingen verbetert voedende gebruik en de groeiprestaties in gespeende varkens. J Anim Sc.i. 2004 April; 82(4): 1053-61.

37. Saha S, Verma R. Inhibitory potentieel van traditionele kruiden op α-amylase activiteit. Pharm Biol. 2012 breng in de war; 50(3): 326-31. Epub 2011 2 Dec.

38. Narita Y, Inouye K. Kinetic analyse en mechanisme op de remming van chlorogenic zuur en zijn componenten tegen varkensalvleesklieralpha-amylase isozymes I en II. J Agric Voedsel Chem. 2009 14 Oct; 57(19): 9218-25.

39. Zentler-Munro PL, Assoufi-BEDELAARS, Balasubramanian K, et al. Therapeutische potentiële en klinische doeltreffendheid van zuurvaste schimmellipase in de behandeling van alvleesklier- steatorrhoea toe te schrijven aan blaasbindweefselvermeerdering. Alvleesklier. 1992;7(3):311-9.

40. Medhekar R. De eerste kwantitatieve bewijsmateriaaltest de doeltreffendheid van supplementaire enzymen: National Enzyme Company; 2004.

41. Beschikbaar bij: betreden http://www.elmhurst.edu/~chm/vchembook/547cellulose.html 1 Oktober, 2012.

42. Lin AH, Lee BH, Nichols-BL, et al. De zetmeelbron beïnvloedt dieetglucosegeneratie op mucosal het α-glucosidase niveau. J Biol Chem. 2012 17 Sep. [Epub voor druk]

43. Stevensce, Hume-identiteitskaart Bijdragen van microben in gewerveld maagdarmkanaal aan productie en behoud van voedingsmiddelen. Physioltoer. 1998 April; 78(2): 393-427.