De LenteUitverkoop van de het levensuitbreiding

Het Tijdschrift van de het levensuitbreiding

Het Tijdschrift Februari 2013 van de het levensuitbreiding
Aangezien wij het zien  

Het voorbereiden van Uw Te eten Lichaam

Door William Faloon

De dynamische Resultaten van het Gewichtsverlies

wordt gemeten  

Om afdoend te bepalen of het groene uittreksel van de koffieboon een anti-zwaarlijvigheids voordeel , wetenschappersopstelling een willekeurig verdeelde, dubbelblinde, placebo-gecontroleerde, lineaire dosis, oversteekplaatsstudie op mensen heeft.1

In een oversteekplaatsstudie, worden de deelnemers gecirkeld door verschillende fasen van behandeling en placebo. In dit geval, namen de onderwerpen een hoge dosis het groene uittreksel van de koffieboon 6 weken, een lager de boon uittreksel van de dosis groen koffie 6 weken, en een placebo 6 weken op een willekeurig verdeelde, dubbelblinde manier. Tussen fasen, was er een „wegspoelings“ periode van 2 weken, makend de volledige studie 22 weken snak.1

De oversteekplaatsstudies worden beschouwd als correct, omdat elke persoon in de testgroep als zijn of haar eigen controle dient. Dit verbetert de kansen om een nauwkeurig resultaat te krijgen, omdat het de mogelijkheid van het resultaat elimineert die op een verschil tussen de actieve en controlegroepen wijzen. Om de bevindingen te verzekeren waren meer vertegenwoordiger, wierf het onderzoek zowel mannen als vrouwen aan.

De deelnemers werden beperkt tot hen die zwaarlijvig of pre-zwaarlijvig gerangschikt waren, omdat de mensen die deze voorwaarden hebben onderworpen aan de metabolische gevolgen van de zwaarlijvigheid zijn en gewichtsverlies moeilijk vinden te bereiken.

Om verder ervoor te zorgen dat om het even welk effect op gewicht, lichaamsvet of BMI alleen aan het uittreksel zou kunnen worden toegeschreven, waren er geen significante veranderingen in dieetcalorieën of in de dieetpercentages koolhydraten, vet, en proteïnen op elk ogenblik tijdens de studie. Er waren ook geen significante veranderingen in oefening. De dagelijkse 350 mg- capsules van het groene uittreksel van de koffieboon waren de enige interventie, hoewel in een niet-studiesituatie, de mensen die gewichts naar vermindering streven ideaal gezien het groene uittreksel van de koffieboon met lagere calorieconsumptie en grotere fysische activiteit zouden combineren om maximumgewichtsverlies te bevorderen.

Tijdens de hoog-dosisfase, keer dagelijks namen de onderwerpen 350 mg van uittreksel, drie. De lagere dosisfase omvatte 350 tweemaal daags genomen mg van uittreksel .1 de placebofase impliceerde dagelijks een 350 mg- dosis drie keer van een inerte capsule die een inactieve substantie bevatten.1

De opvallende resultaten werden gepubliceerd in Januari 2012.

Over de 22 weekproef, vonden de onderzoekers dat alle onderwerpen een vermindering van lichaamsgewicht, BMI, en lichaamsvet tijdens zowel de hoog-dosis als laag-dosisfasen van de studie, maar niet in de placebofase ervoeren!

Na 12 weken van het beheer van uittreksel van de de koffie boon van 350 mg het groene drie keer per dag vonden de wetenschappers dat:1

  • Het gewicht verminderde door meer dan 17.6 ponden gemiddeld-met sommige onderwerpen die meer dan 22.7 ponden verliezen!
  • BMI door een gemiddelde van 2.92 is verminderd die!
  • Lichaamsvet percentage door een gemiddelde 4.44% , met sommige onderwerpen is verminderd die hun lichaamsvetpercentage laten vallen door 6.44% die!
  • Het harttarief door een significant gemiddelde van 2.56 is verminderd slaat per minuut die!

Het wezenlijke anti-zwaarlijvigheidseffect werd duidelijk weerspiegeld in het vinden dat een opmerkelijke 37% van deelnemers die zoals hebbend pre-zwaarlijvigheid ( 25-30 BMI) bij het begin van de studie werden beoordeeld hun die voorwaarde had aan de normaal-gewichts waaier wordt omgekeerd!1

Een studiefollow-up toonde aan dat, tegenover elkaar stellend met voedsel-beperking diëten, een verrassende 87.5% van de testonderwerpen hun gewichts verlies kon handhaven na het afronden van de studie.1 geen bijwerkingen werden waargenomen.

Dit en andere studies toont het belang om „uw lichaam voor te bereiden te eten“ door het groene uittreksel van de koffieboon vóór elke maaltijd aan te nemen. De dubbele gevolgen van het verminderen van na-maaltijd glucose en het veroorzaken van zinvol gewichtsverlies maken tot het een supplement dat vrijwel elke verouderende persoon zou moeten nemen alvorens te eten.

Dodelijk Effect van Zwaarlijvigheid
Voedsel

Volgens de Wereldgezondheidsorganisatie zijn zowat 1.5 miljard mensen zwaarlijvig of te zwaar.68

Elk van deze zwaarlijvige die individuen aan worden gelanceerd drie keer verhoogde risico van dood in vergelijking met normaal-gewichtsmensen.69

De zwaarlijvigheid resulteert in het verkorten van de levensduur tegen een gemiddelde acht tot 10 die jaar met mensen bij normaal gewicht wordt vergeleken. Voor elke 33 extra ponden, stijgt het risico van vroege dood met rond 30 percenten.70

De gezondheidszorgkosten verbonden aan zwaarlijvigheid overschrijden die verbonden aan het roken! 71

Voorbij enkel het goed het kijken, is afwerpen van extra ponden een bewezen reddingsstrategie.

Nieuwe Benadering van Omgekeerde Vette Accumulatie

Close-up van groene koffiebonen  

De omkerende zwaarlijvigheid vereist aanvallend het op verscheidene voorzijden, met inbegrip van oefening, dieet, en nieuwe acties zoals agressief het verminderen van glucose en insuline bloedniveaus.

Het goede nieuws is dat de wetenschappers hebben bevestigd dat het groene uittreksel van de koffieboon bepaalde zwaarlijvigheid-veroorzakende processen kan remmen. De koffiesamenstellingen kunnen lichaamsvet verminderen, verbeteren 64.66.72 lipideprofielen, vermindert 73-75 bloedglucose,73.76 en kan de absorptie van calorieën verminderen!46,66 er zijn vele dieetplannen dat de mensen kunnen op dit ogenblik worden geïmpliceerd met. Door 350 mg van het groene uittreksel van de koffieboon vóór elke maaltijd te nemen, kunnen de vette verliesgevolgen worden vergroot.1

In de studie die gewichts verlies van 17.6 ponden na 12 weken tonen, werden de menselijke onderwerpen verteld om geen significante veranderingen in caloriesamenstelling, calorieopname, of oefeningsgewoonten aan te brengen!1 het is belangrijk om te begrijpen, echter, dat de mensen die de tijd om aan de studies van het gewichtsverlies vergen deel te nemen resultaten willen zien, en kan sommige calorieën instinctief snijden en actiever worden zelfs wanneer zij niet aan worden verteld. 

Om deze natuurlijke benadering te optimaliseren, zouden de te zware en zwaarlijvige individuen het groene uittreksel van de koffieboon en andere voedingsmiddelen zoals chromium en groen thee uittreksel vóór elke maaltijd moeten nemen.

Sparen Geld terwijl het Steunen van Onderzoek

Telkens als u een product dat van het Levensextension® koopt, draagt u tot onderzoek bij op het uitbreiden van gezonde menselijke levensduur wordt gericht. Het leven Extension® zet voort om een verslagaantal wetenschappelijke projecten te financieren, terwijl het vechten van incompetente bureaucraten die medische innovatie willen verstikken.

Tijdens onze 24ste jaarlijkse de winter Super Verkoop, zijn alle formules van het Levensextension® voorzien zodat de leden bijgewerkte versies aan de laagste prijzen van het jaar kunnen verkrijgen.

Tot 31 Januari, 2013, halen voordeel de leden uit Super die Verkoop kortingen omhoog aan voorraad op scherp-randformules worden ontworpen om de onderliggende mechanismen te omringen om… met inbegrip van dodelijke surplus opslag van vette ponden te verouderen.

Voor het langere leven,

Voor het Langere Leven 

William Faloon

Verwijzingen

  1. Vinson JA, Burnham-BR, Nagendran MV. De willekeurig verdeelde, dubbelblinde, placebo-gecontroleerde, lineaire dosis, de oversteekplaatsstudie om de doeltreffendheid te evalueren en de veiligheid van een groene koffieboon halen bij te zware onderwerpen. Diabetes Metab Syndr Obes. 2012;5:21-7.
  2. Benn M, tybjaerg-Hansen A, McCarthy MI, Jensen GB, Grande P, Nordestgaard BG. Nonfastingsglucose, ischemische hartkwaal, en myocardiaal infarct: een mendeliaanse randomization studie. J Am Coll Cardiol. 2012 Jun 19; 59(25): 2356-65.
  3. Bjornholtjv, Erikssen G, Aaser E, et al. Het vasten bloedglucose: een onderschatte risicofactor voor cardiovasculaire dood. Resultaten van een 22-jaar follow-up van gezonde nondiabetic mensen. Diabeteszorg. 1999 Januari; 22(1): 45-9.
  4. Beschikbaar bij: http://www.bls.gov/opub/uscs/1950.pdf.  Betreden 31 Oktober, 2012.
  5. Beschikbaar bij: http://www.ers.usda.gov/data-products/food-expenditures.aspx.  Betreden 31 Oktober, 2012.
  6. Beschikbaar bij: http://healthland.time.com/2011/11/17/are-smokers-today-more-addicted-than-in-the-past/. Betreden 31 Oktober, 2012.
  7. Beschikbaar bij:  http://www.gallup.com/poll/109048/us-smoking-rate-still-coming-down.aspx.  Betreden 31 Oktober, 2012.
  8. Beschikbaar bij:  http://www.cdc.gov/nchs/fastats/overwt.htm.  Betreden 31 Oktober, 2012.
  9. Ceriello A. Mechanisms van weefselschade in de staat na de maaltijd. Supplement van int. J Clin Pract. 2001 Sep; (123): 7-12. 
  10. Vlassara H. Advanced glycationeindproducten en atherosclerose. Ann Med. 1996 Oct; 28(5): 419-26.
  11. Ceriello A. Impaired glucosetolerantie en hart- en vaatziekte: de mogelijke rol van post prandial hyperglycemie. Am Heart J.2004 mag; 147(5): 803-7.
  12. Timmer JR, Hoekstra M, Nijsten mw, et al. De voorspellende waarde van toelatings glycosylated hemoglobine en glucose in nondiabetic patiënten met ST-segment-Verhoging myocardiaal infarct behandelde met percutane coronaire interventie. Omloop. 2011 9 Augustus; 124(6): 704-11.
  13. Norhammar A, Schenck-Gustafsson K. Type - diabetes 2 en hart- en vaatziekte in vrouwen. Diabetologia. 2012 4 Sep. [Epub voor druk]
  14. Donahue RP, Abbott RD, Rietdm, et al. De concentratie van de Postchallengeglucose en coronaire hartkwaal bij mensen van Japans voorgeslacht. Het Hartprogramma van Honolulu. Diabetes. 1987 Jun; 36(6): 689-92.
  15. Volledigere JH, Shipley MJ, nam G, et al. toe: Coronair-hart-ziekterisico en geschade glucosetolerantie. De Whitehall-Studie. Lancet. 1980 Jun 28; 1(8183):1373-6.
  16. Haheim LL, Holme I, Hjermann I, et al.: De glucose van het Nonfastingsserum en het risico van fatale slag bij diabetes en nondiabetic onderwerpen. 18-jaar follow-up van de Studie van Oslo. Slag. 1995 Mei; 26(5): 774-7.
  17. Zeymer U. Cardiovascular voordelen van acarbose in geschaad glucosetolerantie en type - diabetes 2. Int. J Cardiol. 2006 8 Februari; 107(1): 11-20.
  18. Minatoguchi S, Zhang Z, Bao N, et al. Acarbose vermindert myocardiale infarctgrootte door hyperglycemie na de maaltijd en hydroxyl radicale productie te verhinderen en mitochondrial KATP-kanalen bij konijnen te openen. J Cardiovasc Pharmacol. 2009 Juli; 54(1): 25-30.
  19. Frantz S, Calvillo L, Tillmanns J, et al. De herhaalde hyperglycemie na de maaltijd verhoogt hartischemie/reperfusieverwonding: preventie door de alpha--glucosidaseinhibitor acarbose. FASEB J.2005 April; 19(6): 591-3.
  20. Parken EJ, Parken EJ. Veranderingen in vette die synthese door dieet macronutrient inhoud wordt beïnvloed. Soc. van Procnutr. 2002 Mei; 61(2): 281-6.
  21. Raffoul JJ; Guo Z; Soofi A; Heydari AR. Warmtebeperking en genomic stabiliteit. J Nutr Gezondheid het Verouderen. 1999 3(2):102-10.
  22. Martins C, Morgan LM, Robertson-M.D. Gevolgen van beheerst het eten gedrag voor insulinegevoeligheid in normaal-gewichtsindividuen. Physiol Behav. 2009 breng 23 in de war; 96 (4-5): 703-8.
  23. Heilbronn LK, DE Jonge L, Frisard MI, et al. Effect van de caloriebeperking van 6 maanden op biomarkers van levensduur, metabolische aanpassing, en oxydatieve spanning in te zware individuen: een willekeurig verdeelde gecontroleerde proef. JAMA. 2006 5 April; 295(13): 1539-48.
  24. Heller rf, Heller rf. Hyperinsulinemiczwaarlijvigheid en koolhydraatverslaving: de ontbrekende schakel is de factor van de koolhydraatfrequentie. Med Hypotheses. 1994 Mei; 42(5): 307-12.
  25. Zhang X, Zhang G, Zhang H, Karin M, Bai H, Cai D. Hypothalamic IKKbeta/NF-kappaB en ER beklemtoont verbindingsovernutrition aan energieonevenwichtigheid en zwaarlijvigheid. Cel. 2008 3 Oct; 135(1): 61-73.
  26. Danielsson A, Fagerholm S, Ost A, et al. Te veel eten het op korte termijn veroorzaakt insulineweerstand in vette cellen bij magere menselijke onderwerpen. Mol Med. 2009 juli-Augustus; 15 (7-8): 228-34.
  27. Basu R, Chandramouli V, Dicke B, Landauer B, Rizza R. Obesity en type - diabetes 2 schaadt insuline-veroorzaakte afschaffing van glycogenolysis evenals gluconeogenesis. Diabetes. 2005 Juli; 54(7): 1942-8.
  28. Kim DH, Perdomo G, Zhang T, et al. FoxO6 integreert insuline die met gluconeogenesis in de lever signaleren. Diabetes. 2011 Nov.; 60(11): 2763-74.
  29. DE Koning L, Malik VERSUS, Kellogg M.D., Rimm EB, Willett-WC, FB van HU. Gezoete drankconsumptie, inherente coronaire hartkwaal, en biomarkers van risico bij mensen. Omloop. 2012 10 April; 125(14): 1735-41, S1.
  30. Gerstein HC, Pais P, Pogue J, Yusuf S. Relationship van glucose en insulineniveaus aan het risico van myocardiaal infarct: een geval-controle studie. J Am Coll Cardiol. 1999 breng in de war; 33(3): 612-9.
  31. D'Elia JN, Salyers aa.  Bijdrage van een neopullulanase, pullulanase, en een alpha--glucosidase tot de groei van Bacteroides thetaiotaomicron op zetmeel. J Bacteriol. 1996 Dec; 178(24): 7173-9.
  32. Oyama T, Saiki A, Endoh K, et al. Effect van acarbose, een alpha--glucosidaseinhibitor, op serumlipoprotein de niveaus van de lipasemassa en gemeenschappelijke slagader intima-middelen dikte van de halsslagader in type - mellitus diabetes 2 behandeld door sulfonylurea. J Atheroscler Thromb. 2008 Jun; 15(3): 154-9.
  33. Caton PW, Nayuni NK, Kieswich J, Khan NQ, Yaqoob-MM., Corder R. Metformin onderdrukt levergluconeogenesis door inductie van SIRT1 en GCN5. J Endocrinol. 2010 April; 205(1): 97-106.
  34. Otto M, Breinholt J, Westergaard N. Metformin remt glycogeensynthese en gluconeogenesis in beschaafde rattenhepatocytes. Diabetes Obes Metab. 2003 Mei; 5(3): 189-94.
  35. Perriello G, Misericordia P, Volpi E, Santucci A, Santucci C, Ferrannini E, Ventura MM., Santeusanio F, Brunetti P, Bolli GB. Scherpe antihyperglycemic mechanismen van metformin in NIDDM. Bewijsmateriaal voor afschaffing van lipideoxydatie en leverglucoseproductie. Diabetes. 1994 Juli; 43(7): 920-8.
  36. Saxena P, Prakash A, Nigam A. Effect van metformintherapie op 2 h-niveaus van de post-glucoseinsuline in patiënten van polycystic ovariaal syndroom. J Sc.i van Gezoemreprod. 2010 Sep; 3(3): 139-42.
  37. Verma S, Bhanot S, McNeill JH. Metformin vermindert de niveaus van de plasmainsuline en systolische bloeddruk bij ratten spontaan met te hoge bloeddruk. Am J Physiol. 1994 Oct; 267 (4 PT 2): H1250-3.
  38. Isakovic A, Harhaji L, Stevanovic D, et al. Dubbele antigliomaactie van metformin: de arrestatie van de celcyclus en mitochondria-afhankelijke apoptosis. Cel Mol Life Sci. 2007 Mei; 64(10): 1290-302.
  39. Xie Y, Wang YL, Yu L, et al. Metformin bevordert de uitdrukking van de progesteronereceptor via remming van zoogdierdoel van rapamycin (mTOR) in endometrial kankercellen. J Steroid Biochemie Mol Biol. 2011 Sep; 126 (3-5): 113-20.
  40. Ben Sahra I, Regazzetti C, Robert G, et al. Metformin, onafhankelijk van AMPK, veroorzaakt mTOR remmings en cel-cyclus arrestatie door REDD1. Kanker Onderzoek. 2011 1 Juli; 71(13): 4366-72.
  41. Micic D, Cvijovic G, Trajkovic V, Duntas links, Polovina S. Metformin: zijn nieuwe rol in oncologie. Hormonen (Athene). 2011 januari-breng in de war; 10(1): 5-15.
  42. NGO kW, Hsu A, Tan BK. Chlorogenic zuur bevordert glucosevervoer in skeletachtige spier via AMPK-activering: een medewerker aan de gunstige gevolgen van koffie voor diabetes. PLoS. 2012 7(3): e32718.
  43. Abidoffmt. Speciaal klinisch rapport over gevolgen van glucose-6-phosphatase voor menselijke onderwerpen. Russisch Ministerie van volksgezondheid, Moskou, 1999. Ongepubliceerde studie.
  44. Nagendran MV. Effect van het groene uittreksel van de koffieboon (GCE), hoog in Chlorogenic Zuren, op Glucosemetabolisme. Het aantal van de affichepresentatie: 45-pond-p. Zwaarlijvigheid 2011, de 29ste Jaarlijkse Wetenschappelijke Vergadering van de Zwaarlijvigheidsmaatschappij. Orlando, Florida. 1-5 oktober, 2011.
  45. Ishikawa A, Yamashita H, Hiemori M, et al. Karakterisering van inhibitors van hyperglycemie na de maaltijd van de bladeren van Nerium-indicum. J Nutr Sc.i Vitaminol (Tokyo). 2007 April; 53(2): 166-73.
  46. Henry-Vitrac C, Ibarra A, Rol M, Merillon JM, Vitrac X. Contribution van chlorogenic zuren aan de remming van menselijke lever glucose-6-phosphatase activiteit in vitro door Svetol, een gestandaardiseerd cafeïnevrij gemaakt groen koffieuittreksel. J Agric Voedsel Chem. 2010 14 April; 58(7): 4141-4.
  47. Andrade-Cetto A, Vazquez RC. Gluconeogenesis remming en fytochemische samenstelling van twee Cecropia-species. J Ethnopharmacol. 2010 6 Juli; 130(1): 93-7.
  48. Anderson RA, Cheng N, Bryden-Na, et al. De opgeheven opnamen van supplementair chromium verbeteren glucose en insulinevariabelen in individuen met type - diabetes 2. Diabetes. 1997 Nov.; 46(11): 1786-91.
  49. Lamson DW, Plein SM. De veiligheid en de doeltreffendheid van hoog-dosischromium. Altern Med Rev. 2002 Jun; 7(3): 218-35.
  50. Bahijri SM. Effect van chromiumaanvulling op glucosetolerantie en lipideprofiel. Saoedi-arabisch Med J.2000 Januari; 21(1): 45-50.
  51. Tsuneki H, Ishizuka M, Terasawa M, Wu JB, Sasaoka T, Kimura I. Effect van groene thee op de niveaus van de bloedglucose en serum proteomic patronen in de diabetesmuizen (van db/db) en op glucosemetabolisme in gezonde mensen. BMC Pharmacol. 2004 26 Augustus; 4:18.
  52. Venablesmc, Hulston CJ, Cox u, Jeukendrup VE. De groene opname van het theeuittreksel, vette oxydatie, en glucosetolerantie in gezonde mensen. Am J Clin Nutr. 2008; 87(3) 778-84.
  53. Deng ZY, Tao LANGS, et al. Effect van groene thee en zwarte thee op bloedglucose, triglyceride, en anti-oxyderend bij oude ratten. J Agricult Voedsel Chem. 1998 46(10):3875-78.
  54. Collins QF, Liu HY, Pi J, et al. Epigallocatechin-3-gallate (EGCG), groene thee onderdrukt polyphenol, levergluconeogenesis door 5 ' - ampère-Geactiveerd eiwitkinase. J Biol Chem. 2007 12 Oct; 282(41): 30143-9.
  55. Cao H, hininger-Favier I, Hoedendoctorandus in de letteren, et al. Het groene theepolyphenol uittreksel regelt de uitdrukking van genen betrokken bij glucosebegrijpen en de insuline die bij ratten signaleren voedde een hoge fructosedieet. J Agric Voedsel Chem. 2007 25 Juli; 55(15): 6372-8.
  56. Ngondi JL, Etoundi BC, Nyangono-CITIZENS BAND, Mbofung cm, Oben JE. IGOB131, een nieuw zaaduittreksel van het Westen - de Afrikaanse installatieirvingia gabonensis, vermindert beduidend lichaamsgewicht en verbetert metabolische parameters in te zware mensen in een willekeurig verdeeld dubbelblind placebo gecontroleerd onderzoek. Lipidengezondheid Dis. 2009 breng 2 in de war; 8:7.
  57. Ngondi JL, Fossouo E, Djiotsa EJ, Oben J. Glycaemic variaties na beleid van de fracties van Irvingia gabonensiszaden bij normoglycemic ratten. Afrj Trad CAM. 2006; 3:94101.
  58. Adamson I, Okafor C, Abu-Bakare A. Een supplement van Dikanut (Irvingia-gabonesis) verbetert behandeling van type II diabetici. Med van het westenafr J. 1990 april-Jun; 9(2): 108-15.
  59. Zhang Y, Lee ET, Cowan LD, Fabsitz rr, Howard BV. Koffieconsumptie en de weerslag van type - diabetes 2 in mannen en vrouwen met normale glucosetolerantie: De sterke Hartstudie. Nutr Metab Cardiovasc Dis. 2011 Jun; 21(6): 418-23.
  60. Johnston KL, Clifford-Mn, Morgan LM. De koffie wijzigt scherp gastro-intestinale hormoonafscheiding en glucosetolerantie in mensen: glycemic gevolgen van chlorogenic zuur en cafeïne. Am J Clin Nutr. 2003 Oct; 78(4): 728-33.
  61. Narita Y, Inouye K. Kinetic analyse en mechanisme op de remming van chlorogenic zuur en zijn componenten tegen varkensalvleesklieralpha-amylase isozymes I en II. J Agric Voedsel Chem. 2009 14 Oct; 57(19): 9218-25.
  62. Tunnicliffe JM, Eller LK, Reimer-Ra, Hittel DS, Shearer J. Chlorogenic zuur beïnvloedt glucose differentially na de maaltijd en glucose-afhankelijke insulinotropic polypeptidereactie bij ratten. Appl Physiol Nutr Metab. 2011 Oct; 36(5): 650-9.
  63. Loopstra-meesters RC, Liese-ADVERTENTIE, Haffner SM, Wagenknecht le, AJ Hanley. De verenigingen tussen de opname van caffeinated en maakten koffie en maatregelen van insulinegevoeligheid en bètacelfunctie cafeïnevrij. Diabetologia. 2011 Februari; 54(2): 320-8.
  64. Shimoda H, Seki E, Aitani M. Inhibitory effect van het groene uittreksel van de koffieboon op vette accumulatie en lichaamsgewicht bereikt in muizen. BMC- Med van Aanvullingsaltern. 2006 breng 17 in de war; 6:9.
  65. Bakuradze T, Boehm N, Janzowski C, et al. De anti-oxyderend-rijke koffie vermindert DNA-schade, heft glutathione status op en draagt tot gewichtscontrole: bij resultaten van een interventiestudie. Mol Nutr Food Res. 2011 Mei; 55(5): 793-7.
  66. Thom E. The-effect van chlorogenic zuur verrijkte koffie op glucoseabsorptie in gezonde vrijwilligers en zijn effect op lichaamsmassa wanneer gebruikte lange termijn in te zware en zwaarlijvige mensen. J Int. Med Res. 2007;35(6):900-8.
  67. Onakpoya I, Terry R, Ernst E. The-gebruik van groen koffieuittreksel als supplement van het gewichtsverlies: een systematische overzicht en een meta-analyse van willekeurig verdeelde klinische proeven. Gastroenterol Onderzoek Pract. 2011; P.II van 2011.: 382852.
  68. Beschikbaar bij: http://www.who.int/mediacentre/factsheets/fs311/en/. Betreden op 24 April, 2012.
  69. Adams KF, Schatzkin A, Harris-TB, et al. Overgewicht, zwaarlijvigheid, en mortaliteit in een grote prospectieve cohort van personen 50 tot 71 jaar oud. N Engeland J Med. 2006 24 Augustus; 355(8): 763-78.
  70. Beschikbaar bij: http://www.oecd.org/dataoecd/1/61/49716427.pdf. Betreden 24 April, 2012
  71. Moriarty J, Branda M, Olsen Kerry, et al. De gevolgen van stijgende kosten om en zwaarlijvigheid op gezondheidszorgkosten onder volwassenen te roken: Een longitudinale studie van 7 jaar. J Occup omgeeft Med. 2012 Maart; 54(3): 286-91.
  72. Murase T, Misawa K, Minegishi Y, Aoki M, Ominami H, Suzuki Y, Shibuya Y, Hase T. Coffee polyphenols onderdrukt dieet-veroorzaakte lichaamsvetaccumulatie door downregulating SREBP-1c en verwante molecules in C57BL/6J-muizen. Am J Physiol Endocrinol Metab. 2011 Januari; 300(1): E122-33.
  73. Li SY, Chang CQ, Ma FY, Yu-cl. De modulerende gevolgen van chlorogenic zuur voor lipiden en glucosemetabolisme en de uitdrukking van lever peroxisome proliferator-geactiveerde receptor-alpha- in gouden hamsters voedden op hoogte - vet dieet. Biomed omgeeft Sc.i. 2009 April; 22(2): 122-9.
  74. Superko u, Bortz W Jr, Williams PT, Albers JJ, Houten PD. Caffeinated en cafeïnevrij gemaakte koffiegevolgen voor plasmalipoprotein cholesterol, apolipoproteins, en lipaseactiviteit: een gecontroleerde, willekeurig verdeelde proef. Am J Clin Nutr. 1991 Sep; 54(3): 599-605.
  75. Cho ZOALS, Jeon SM, Kim MJ, Yeo J, Seo KI, Choi-lidstaten, Lee MK. Chlorogenic zuur stelt anti-zwaarlijvigheidsbezit tentoon en verbetert lipidemetabolisme in high-fat dieet-veroorzaken-zwaarlijvige muizen. Voedsel Chem Toxicol. 2010 breng in de war; 48(3): 937-43.
  76. Bidel S, HU G, Sundvall J, Kaprio J, Tuomilehto J. Effects van koffieconsumptie op glucosetolerantie, serumglucose en insulineniveaus: een analyse in dwarsdoorsnede. Horm Metab Onderzoek. 2006;38(1):38-43.