Het Bloedonderzoek Super Verkoop van de het levensuitbreiding

Het Tijdschrift van de het levensuitbreiding

Het Tijdschrift Juli 2012 van de het levensuitbreiding
Rapport

Verminder snel van de Bloedglucose en Loods Ponden!

Door Michael Downey
VERMINDER SNEL van de Bloedglucose en Loods Ponden!

Volgens de Wereldgezondheidsorganisatie, zijn zowat 1.5 miljard mensen zwaarlijvig of te zwaar.1 elk van deze zwaarlijvige individuen lanceert aan een drie keer verhoogd risico van dood in vergelijking met normaal-gewichtsmensen.2

De zwaarlijvigheid resulteert in het verkorten van de levensduur tegen een gemiddelde acht tot tien die jaar met mensen bij normaal gewicht wordt vergeleken. Voor elke 33 extra ponden, stijgt het risico van vroege dood met rond 30%.3 voorbij enkel het goed het kijken, is afwerpen van extra ponden een bewezen reddingsstrategie.

Het goede nieuws is dat de wetenschappers hebben geconstateerd dat het groene uittreksel van de koffieboon in een unieke manier kan tussenbeide komen om het proces achter zwaarlijvigheid te remmen.

Nu gezien als een complexe metabolische ziekte zelf en niet slechts een „risicofactor,“zwaarlijvigheid 4 komt voor wanneer de bovenmatige calorieconsumptie de bevoegdheid van het lichaam overweldigt om calorieën als energie te besteden.5-9 toen, veroorzaakt het proces van de zwaarlijvigheidsziekte verdere verhogingen van lichaamsvet en bloedglucoseniveaus.

In dit artikel, zult u leren hoe chlorogenic zure samenstellingen in groene koffieboon het werk in de darmkanaal halen om de absorptie van calorieën te remmen!10-11 het groene uittreksel van de koffieboon werkt ook langs veelvoudige wegen om [lichaams] vet 12-16en glucose niveaus te verminderen!15,17-27

In een kleine maar dwingende placebo-gecontroleerde studie meldde Januari 2012, een formulering van groen veroorzaakt het gewichtsverlies van de koffieboon uittreksel in 100% van het overgewicht deelnemer-dat een gemiddelde meer dan 17.6 ponden verloor en hun lichaamsvet verminderde!28

Zonder hun consumptie van calorieën, proteïne, of koolhydraten, of hun oefeningsgewoonten te veranderenkeerde een opmerkelijke 37% van deelnemers hun pre-zwaarlijvigheids status (25-30 BMI) terug in de normaal-gewichtswaaier om!28

Zwaarlijvigheid als „Chronische Metabolische Ziekte nu wordt gedefinieerd die“

Zwaarlijvigheid als Chronische Metabolische Ziekte nu wordt gedefinieerd die

Het recente onderzoek plaatste de totale risico's van zwaarlijvigheid in duidelijk en angstaanjagend perspectief: de wetenschappers besloten dat de gezondheidszorgkosten verbonden aan zwaarlijvigheid die verbonden aan het roken overschrijden!29 met dat niveau van risico, is het belangrijk dat wij zwaarlijvigheid als complexe ziekte bekijken dat de wetenschappers het nu om kennen te zijn.4

Als ziekte, erkent de wetenschappelijke gemeenschap nu specifiek zwaarlijvigheid om een chronische metabolische wanorde, te zijn die een belangrijke rol in de inductie van velen van de leeftijd afhankelijke ziekte-en vroege dood speelt.30 de zwaarlijvigheid verandert de long, endocriene, en immunologische functies van het lichaam.4

Bijvoorbeeld, besloot een studie dat het vet (vette) weefsel eenvoudig een passief vet pakhuis is, maar geen actief endocrien orgaan geschikt om een verscheidenheid van molecules samen te stellen en hen vrij te geven van de bloedsomloop, waar zij het normale metabolische saldo kunnen onderbreken en een gastheer van ziekten veroorzaken.30,31

De wetenschappers hebben dat deze metabolische verstoring diabetes kan teweegbrengen , hypertensie31 en hart- en vaatziekte, 30.31niet-alkoholische vettige leverziekte (NAFLD), 32.33lever en colorectal kanker, 33en diverse spijsverteringsziekten geleerd.32

Met deze risicofactoren, is het gemakkelijk om te begrijpen waarom de zwaarlijvigheid een hoger risico 200-300% van dood dan zijnd van normaal gewicht 3impliceert— en waarom het bovenmatige lichaamsvet bijna 2 van de 3 mensen van zowel kwaliteit als hoeveelheid het leven kan roven.1,4

Het al lang bestaande antwoord van de medische onderneming op de zwaarlijvigheidsepidemie is „meer oefening en een uitgebalanceerd dieet.“ geweest En komt het lichaamsgewicht vaak neer in antwoord op het slaan van een evenwicht tussen energie (voedsel) opname en energieuitgaven (fysische activiteit).7-9

Maar de bijdrage van andere factoren is slecht begrepen, en de zwaarlijvigheid kan, voor een deel, een reactie op milieustimuli, genetische neiging, en endocrinologische (hormonale) abnormaliteiten zijn.4

Het omkeren van een zwaarlijvigheidsepidemie van deze omvang vereist aanvallend het op verscheidene voorzijden, met inbegrip van oefening, dieet-en nieuwe acties. Zo hebben de wetenschappers de veiligste en meest efficiënte, natuurlijke agenten onderzocht die de capaciteit zouden kunnen houden het onderliggende proces van de zwaarlijvigheid actief om te stoppen.

Na de Aanwijzingen aan een Unieke Zwaarlijvigheidsinterventie

Het uitgebreide epidemiologische bewijsmateriaal had eerder aangetoond dat een hoog niveau van koffie consumptie het risico van type - diabetes 2 door 67% vermindert.34 dit anti-diabetic effect scheen om uit beperkte mate van bloedglucose voort te vloeien, verhoogde insulinegevoeligheid, en verminderde opslag van zowel vet als koolhydraat.

Aan wetenschappers, stelde dit voor dat de samenstellingen in de koffieboon spijsvertering of metabolisme kunnen op de een of andere manier wijzigen. Het stelde ook voor, bevestigd door een recenter overzicht,35 dat het anti-diabetic voordeel van koffie uit gewicht-vermindert kan stammen gevolg-omdat het bovenmatige gewicht een bekende risicofactor voor diabetes is.

Het verdere onderzoek, met inbegrip van een meta-analyse die gegevens over meer dan 450.000 mensen combineerde, ontdekte dat de cafeïnevrij gemaakte koffie dezelfde beschermende gevolgen verstrekte zoals caffeinated.36-40

Dit bewees aan wetenschappers dat de capaciteit van de koffie die spijsvertering of metabolisme te beïnvloeden uit niet-cafeïnesamenstellingen in de koffieboon, zeer waarschijnlijk chlorogenic zuur stamde, misschien door andere samenstellingen van de koffieboon wordt verbeterd.

De studies vonden toen dat de cafeïne glucoseabsorptie bevordert, terwijl chlorogenic zuur in koffie glucosebegrijpen tegenwerkt.21 het doet blijkbaar dit door het glucosebegrijpen naar meer distale gebieden van de dunne darm te verplaatsen.21 het schijnt ook om amylase, het enzym te verbieden dat zetmeel in suiker opsplitst.10

De wetenschappers erkenden van deze bevindingen dat chlorogenic zuren van de koffie een potentiële doorbraak vertegenwoordigden tegen zwaarlijvigheid-omdat deze samenstellingen koffiedrinkers kunnen helpen die diabetes door een remming van gewichtsaanwinst te verhinderen, door een reductie van glucoseniveaus 2en door-Heilige Grail anti-zwaarlijvigheid een inspanning-daling van intestinaal caloriebegrijpen wordt uitgevoerd!10,28

De bevestiging van dit begon met een studie besluitend dat de chlorogenic zuren in koffie glucose-6-phosphatase verbieden, op zijn beurt zich mengt in glucosesynthese en versie binnen het lichaam.19 dit vermindert bloedsuiker niveau-en bevordert gewichtsverlies.

Deze studie vond ook dat chlorogenic zuur de hyperglycemic piek verbonden aan koolhydraatopname vermindert.19 dit vermindert insulineactiviteit en vermindert vetweefsel accumulatie40— allebei verbonden aan gewichtsverlies. Bovendien, heeft het onderzoek bevestigd dat de samenstellingen in koffie vetweefsel verminderen.13

Met stijgende steun voor het gewicht-verlies effect van koffiesamenstellingen, trachten de wetenschappers dan de gevolgen specifiek te onderzoeken van koffie voor gewicht.

In een menselijke studie, resulteerde de dagelijkse consumptie van koffie die aan de samenstellingen rijk was die overvloedig in groene koffiebonen worden gevonden, en ook in geroosterde bonen, inderdaad in een lagere energie (voedsel) opname— die verminderd gewicht en lichaamsvet veroorzaakte.41 de wetenschappers waren benieuwd of zou het nog grotere calorie-blokkerend en gewicht verlies door een hogere concentratie van chlorogenic zuren in de koffie kunnen worden bereikt.17,18

Wat u moet weten: Groene Koffie Bean Extract Combats Obesity
Wat u moet weten: Groene Koffie Bean Extract Combats Obesity
  • Nu het geweten om een chronische ziekte, zwaarlijvigheidte zijn 4 heft het risico van dood door 200-300% op.
  • Het wetenschappelijke onderzoek steunt dat het vet (vette) weefsel eenvoudig een passief vet pakhuis is, maar geen actief endocrien orgaan geschikt om een verscheidenheid van molecules samen te stellen en hen vrij te geven van de bloedsomloop, waar zij de capaciteit hebben om normaal metabolisch saldo te onderbreken en een gastheer van degeneratieve ziekten te veroorzaken. 30,31
  • Gelukkig die, heeft het wetenschappelijke onderzoek aangetoond dat de samenstellingen in het groene uittreksel van de koffieboon kunnen worden gevonden tussenbeide komen om vet 13.16en glucoseniveaus 17.19.21te verminderen— zowel geassocieerd met gewicht aanwinst-en de absorptie van calorieën te verminderen!10
  • Een recente, placebo-gecontroleerde menselijke studie vond dat het groene uittreksel van de koffieboon een gemiddeld gewichtsverlies van 17.6 ponden veroorzaakte!28 voor 37% van onderwerpen, werd hun voorwaarde van pre-zwaarlijvigheid omgekeerd terug naar de normaal-gewichtscategorie!28
  • Deze dwingende resultaten kwamen, verrassend, zonder enige significante verandering in calorieën, proteïne, koolhydraten, of oefening voor!28 zij steunen het groene uittreksel van de koffieboon als unieke en krachtige interventie om zwaarlijvigheid te stoppen.

Groene Koffie Bean Extract Inhibits Calorie Absorption!

Groene Koffie Bean Extract Inhibits Calorie Absorption!

Om het gewicht-verminderend effect te onderzoeken dat in geroosterde en gebrouwen koffie die was getoond, draaiden de wetenschappers aan samenstellingen direct uit groene koffiebonen worden gehaald. De groene koffiebonen bevatten hogere hoeveelheden chlorogenic zuur en andere polyphenol samenstellingen die wezenlijk tijdens het het roosteren procédé worden verloren dat bruin hen draait.

De onderzoekers testten twee agenten op muizen: chlorogenic zuur, een zeer belangrijke groene samenstelling van de koffieboon en een groen uittreksel van de koffieboon. Zij vonden dat chlorogenic zuur alleen een gematigd gewicht-verminderend effect toonde. Nochtans, veroorzaakte het groene uittreksel van de koffie boon groter gewichtsverlies.13 dit werd toegeschreven aan zijn capaciteit om de absorptie van vetten van de darm te remmen en vet metabolisme in de lever te verbeteren.13

De verdere het testen het impliceren veroorzaken-zwaarlijvige muizen beheerden een high-fat dieet (37% calorieën van vet) bevestigden deze bevindingen.16

In ander onderzoek met muizen, koffie verbeterden polyphenols energiemetabolisme, verminderde lipogenesis (de vorming van vet) en remden gewichtsaanwinst. De onderzoekers vonden een afschaffing van lichaamsvet, die uit het downregulating van sterol regelgevende element-band eiwit en verwante molecules voortvloeide.14

Aangemoedigd door het anti-zwaarlijvigheidseffect van deze uittreksels in dieren, ontwierpen de wetenschappers nieuwe experimenten om te bevestigen dat het groene uittreksel van de koffieboon beduidend lichaamsgewicht in mensen zou verminderen.

In een 12 week, placebo-gecontroleerde studie, testten de wetenschappers de doeltreffendheid van het groene uittreksel van de koffieboon. Dertig te zware of zwaarlijvige menselijke die vrijwilligers namen of het uittreksel of een placebo, in onmiddellijke koffie wordt opgelost. Het uittreksel veroorzaakte een gemiddeld verlies van het 11 pondgewicht. Dit werd vergeleken door een daling van glucoseabsorptie en een verhoging van glucosegebruik. De onderzoekers rapporteerden dat de lagere beschikbaarheid van glucose die uit deze gevolgen voortvloeit het lichaam ertoe zou bewegen om het metabolisme van vette reserves te verhogen, die uiteindelijk lichaamsvet en massa zouden verminderen.17

Door dit punt, hadden de wetenschappers wezenlijk bewijsmateriaal dat zowel caffeinated als koffie-en vooral cafeïnevrij maakte geaccumuleerd, het groene uittreksel van de koffieboon— verminder beduidend de absorptie van glucose,17.19.21 en de absorptie van vetten.13,16 er was ook bewijsmateriaal van een daling van enzymamylase,10 die de absorptie van koolhydraten zouden verminderen. Deze gevolgen wezen erop dat het groene uittreksel van de koffieboon absorptie van calorieën vermindert en wezenlijk gewichtsverlies veroorzaakt.17

Een overzicht van 2011 en een meta-analyse van gepubliceerde en ongepubliceerde menselijke studies die willekeurig verdeelde klinische proeven impliceren die het groene uittreksel van de koffieboon in dosissen 180 mg aan 200 mg gebruiken besloten dagelijks dat er een algemene daling van lichaamsgewicht was. Nochtans, besloten de wetenschappers dat het verdere strenge onderzoek nodig was om de gewicht-verlies doeltreffendheid van het uittreksel afdoend te vestigen.42

Dwingende gewicht-Verlies Resultaten

Om afdoend te bepalen dat het groene uittreksel van de koffieboon een machtig anti-zwaarlijvigheids voordeel, wetenschappersopstelling een studie van streng ontwerp heeft: een willekeurig verdeelde, dubbelblinde, placebo-gecontroleerde, lineaire dosis, oversteekplaatsstudie op mensen.

In een oversteekplaatsstudie, worden de deelnemers gecirkeld door verschillende fasen van behandeling en placebo. In dit geval, namen de onderwerpen een hoge dosis het groene uittreksel van de koffieboon 6 weken, een lager de boon uittreksel van de dosis groen koffie 6 weken, en een placebo 6 weken op een willekeurig verdeelde, dubbelblinde manier. Tussen fasen, was er een „wegspoelings“ periode van 2 weken, makend de volledige studie 22 weken snak.

De oversteekplaatsstudies worden beschouwd als correct, omdat elke persoon in de testgroep als zijn of haar eigen controle dient. Dit verbetert de kansen om een nauwkeurig resultaat te krijgen, omdat het de mogelijkheid van het resultaat elimineert die op een verschil tussen de actieve en controlegroepen wijzen. In plaats daarvan, kan om het even welk verschil in resultaten met veel groter vertrouwen aan de verschillende genomen supplementen worden toegeschreven.

Om de bevindingen te verzekeren waren meer vertegenwoordiger, wierf het onderzoek zowel mannen als vrouwen aan.

De deelnemers werden beperkt tot hen die door hun BMI zwaarlijvig of pre-zwaarlijvig werden geclassificeerd, omdat zij die deze voorwaarden hebben onderworpen aan de metabolische gevolgen van de zwaarlijvigheid zijn en gewichtsverlies moeilijk vinden te bereiken.

Om om het even welk verwarrend effect van drugs te vermijden, waren de onderwerpen uitgesloten als zij om het even welke die medicijnen genomen hadden worden gekend om gewicht tijdens de vorige 6 maanden te beïnvloeden.

Om verder ervoor te zorgen dat om het even welk effect op gewicht, lichaamsvet of BMI alleen aan het uittreksel zou kunnen worden toegeschreven, waren er geen significante veranderingen in dieetcalorieën of in de dieetpercentages koolhydraten, vet, en proteïnen op elk ogenblik tijdens de studie. Er waren ook geen significante veranderingen in oefening. De dagelijkse capsules waren de enige interventie, hoewel in een niet-studiesituatie, de mensen die gewichts naar vermindering streven ideaal gezien deze interventie met lagere calorieconsumptie en grotere fysische activiteit zouden combineren om maximumgewichtsverlies te bevorderen.

Tijdens de hoog-dosisfase, keer dagelijks namen de onderwerpen 350 mg van uittreksel, drie. De lagere dosisfase omvatte 350 tweemaal daags genomen mg van uittreksel . De placebofase impliceerde dagelijks een 350 mg- dosis drie keer van een inerte capsule die een inactieve substantie bevatten.

In Januari 2012, meldden de wetenschappers de opvallende resultaten.

Hoewel er geen veranderingen in calorieopname waren of op de 22 weekproef uitoefent, vonden de onderzoekers dat alle onderwerpen een indrukwekkende vermindering van lichaamsgewicht, BMI, en lichaamsvet tijdens zowel de hoog-dosis als laag-dosisfasen van de studie, maar niet in de placebofase ervoeren! Na enkel 12 weken van het beheer van het groene uittreksel van de koffieboon over de cursus van de 22 weekstudie, vonden de wetenschappers dat:28

  • Het gewicht verminderde door meer dan 17.6 ponden gemiddeld-met sommige onderwerpen die meer dan 22.7 ponden verliezen!
  • BMI door een gemiddelde van 2.92 is verminderd die!
  • Lichaamsvet door een gemiddelde 4.44% , met sommige onderwerpen is verminderd die 6.44% van hun lichaamsvet verliezen dat!
  • Het harttarief door een significant gemiddelde van 2.56 is verminderd slaat per minuut die!

Het wezenlijke anti-zwaarlijvigheidseffect werd duidelijk weerspiegeld in het vinden dat een opmerkelijke 37% van deelnemers die zoals hebbend pre-zwaarlijvigheid ( 25-30 BMI) bij het begin van de studie werden beoordeeld hun die voorwaarde had aan de normaal-gewichts waaier wordt omgekeerd!28

Een studiefollow-up toonde aan dat, tegenover elkaar stellend met voedsel-beperking diëten, een verrassende 87.5% van de testonderwerpen hun gewichts verlies kon handhaven na het afronden van de studie.28 geen bijwerkingen werden waargenomen.

Het onderzoeken van de Biochemische Mechanismen

Het onderzoeken van de Biochemische Mechanismen

Het onderzoek naar precies hoe het groene uittreksel van de koffieboon zijn dramatisch pond-afwerpend effect veroorzaakt is in zijn vroege stadia. Nochtans, wijst het bestaande bewijsmateriaal erop dat dit krachtige koffieuittreksel de capaciteit heeft het intestinale begrijpen van glucose, vetten veilig om te verminderen, en koolhydraat-en de absorptie van calorieën te verminderen! Het onderzoek toont aan dat het ook zich in glucosevervoer en de productie en de opslag van vetten mengt; en bevordert gebruik van glucose en analyse van vetten. De wetenschappers speculeren dat zijn veelvoudige biochemische mechanismen kunnen werken:

  • Verbied enzym amylase, die de maagdarmkanaal absorptie van suiker en calorieën 10zou verminderen
  • Meng me in glucose-6-phosphatase, een enzym vaak betrokken bij verwezenlijking van de glucose van het surplusbloed van proteïne en vetten 19
  • Onderdruk accumulatie van lever triglyceride13
  • Verander lichaam-vette distributie16
  • Van de Downregulate vetzuur en cholesterol biosynthese16
  • De oxydatie van het Upregulate vetzuur en uitdrukking van peroxisome proliferator-geactiveerde alpha- receptor (PPAR-Alpha-), een zeer belangrijke regelgever van lipiden en glucose15.16
  • Meng me in glucosevervoer21
  • Verbied alvleesklier- lipase, een enzym dat vetten in spijsverteringskanaal 11opsplitst
  • De vertragingsabsorptie van vetten van de darm, en activeert vet metabolisme in lever13
  • Verbeter energiemetabolisme14
  • Verminder lipogenesis en vette accumulatie door sterol regelgevende element-bindende eiwit en gelijkaardige molecules 14downregulating
  • Verbied het enzym alpha--glucosidase, die apart complexe suikers breekt en hun absorptie in bloed 43verbetert
  • Verhoog de signaalproteïne voor insulinereceptoren in levercellen, stijgende insulinegevoeligheid en dalende glucoseniveaus22
  • Werk glucosebegrijpen die in de proximale dunne darm tegen, absorptie verplaatsen naar meer distale gebieden van de dunne darm, waarbij algemeen glucosebegrijpen 21wordt verminderd
  • Bevorder synthese van factor idx-1 van de homeodomaintranscriptie, die de insuline-regelende bèta cellen helpt aan verhogingen van plasmaglucose 24antwoorden
  • Bevorder verspreiding van de natrium ionen (Na+) elektrochemische gradiënt, op zijn beurt verminderend glucoseabsorptie27
  • Verbeter whole-body metabolisme, zoals die door grotere zuurstofconsumptie 14wordt getoond

Wat ook het mechanisme is waardoor het groene uittreksel van de koffieboon zijn gunstige gevolgen levert, is het getoond om een uniek anti-zwaarlijvigheids voordeel te hebben: het vermindert wezenlijk lichaamsgewicht en lichaamsvet— zelfs zonder een verandering in oefening of calorieconsumptie!28

Samenvatting

De zwaarlijvigheid verhoogt het risico van chronische ziekten en zet zijn slachtoffers op een groter risico 200-300% van dood.3,4

Het goede nieuws is dat de wetenschappers hebben geconstateerd dat het groene uittreksel van de koffieboon in een unieke manier kan tussenbeide komen om het proces achter zwaarlijvigheid te remmen. Zijn samenstellingen kunnen niveaus van vet 11-16en glucose 14.15.17-27in verminderen lichaam-en kunnen de absorptie van calorieën verminderen!10

In een recente, placebo-gecontroleerde studie over mensen, verminderde het groene uittreksel van de koffie boon gewicht door een opmerkelijk gemiddelde meer dan 17.6 ponden!28 en 37% van deelnemers keerde hun pre-zwaarlijvigheidsstatus terug naar de normaal-gewichtswaaier om!28 deze resultaten bevestigen dat het groene uittreksel van de koffieboon een unieke en machtige interventie is om zwaarlijvigheid te stoppen.

Als u om het even welke vragen over de wetenschappelijke inhoud van dit artikel hebt, te roepen gelieve een de Gezondheidsadviseurvan de het Levens uitbreiding ® bij 1-866-864-3027.

Verwijzingen

1. Beschikbaar bij: http://www.who.int/mediacentre/factsheets/fs311/en/. Betreden op 24 April, 2012.

2. Adams KF, Schatzkin A, Harris-TB, et al. Overgewicht, zwaarlijvigheid, en mortaliteit in een grote prospectieve cohort van personen 50 tot 71 jaar oud. N Engeland J Med. 2006 24 Augustus; 355(8): 763-78.

3. Beschikbaar bij: http://www.oecd.org/dataoecd/1/61/49716427.pdf. Betreden 24 April, 2012.

4. Conway B, Rene A. Obesity als ziekte: geen lichtgewichtkwestie. Obestoer. 2004 3:145-51.

5. Ouchi N, Ohashi K, Shibata R, Murohara T. Adipocytokines en zwaarlijvigheid-verbonden wanorde. Nagoya J Med Sci. 2012 Februari; 74 (1-2): 19-30.

6. Larson-Meyer DE, Heilbronn LK, Redman LM, et al. Effect van caloriebeperking met of zonder oefening op insulinegevoeligheid, bèta-celfunctie, vette celgrootte, en ectopisch lipide bij te zware onderwerpen. Diabeteszorg. 2006 Jun; 29(6): 1337-44.

7. Kant AK, Graubard-bi. Seculaire tendensen in patronen van zelf-gerapporteerde voedselconsumptie van volwassen Amerikanen: NHANES 1971-1975 aan NHANES 1999-2002. Am J Clin Nutr. 2006 Nov.; 84(5): 1215-23.

8. Bagnol D, al-Shamma Ha, Behan D, Whelan K, AJ Grottick. Dieet-veroorzaakte modellen van zwaarlijvigheid (DIO) in knaagdieren. Curr Protoc Neurosci. 2012 April; Hoofdstuk 9: Unit9.38. 9. Eerlijke AM, Montgomery K. Energy-saldo, fysische activiteit, en kankerrisico. Methodes Mol Biol. 2009;472:57-88.

10. Narita Y, Inouye kJ. Kinetisch analyse en mechanisme op de remming van chlorogenic zuur en zijn componenten tegen varkensalvleesklieralpha-amylase isozymes I en II. J Agric Voedsel Chem. 2009;57:9218-25.

11. NGO kW, Hsu A, Tan BK. Chlorogenic zuur bevordert glucosevervoer in skeletachtige spier via AMPK-activering: een medewerker aan de gunstige gevolgen van koffie voor diabetes. PLoS. 2012; 7(3): e32718.

12. Superko u, Bortz W Jr, Williams PT, Albers JJ, Houten PD. Caffeinated en cafeïnevrij gemaakte koffiegevolgen voor plasmalipoprotein cholesterol, apolipoproteins, en lipaseactiviteit: een gecontroleerde, willekeurig verdeelde proef. Am J Clin Nutr. 1991;54:599-605.

13. Shimoda H, Seki E, Aitani M. Inhibitory effect van het groene uittreksel van de koffieboon op vette accumulatie en lichaamsgewicht bereikt in muizen. BMC-Med van Aanvullingsaltern. 2006;6:9.

14. Murase T, Misawa K, Minegishi Y, et al. Koffiepolyphenols onderdrukken dieet-veroorzaakte lichaamsvetaccumulatie door downregulating SREBP-1c en verwante molecules in C57BL/6J-muizen. Am J Physiol Endocrino Metab. 2011; 300: E122-33.

15. Li SY, Chang CQ, Ma FY, Yu-cl. De modulerende gevolgen van chlorogenic zuur voor lipiden en glucosemetabolisme en de uitdrukking van lever peroxisome proliferator-geactiveerde receptor-alpha- in gouden hamsters voedden op hoogte - vet dieet. Biomed omgeeft Sc.i. 2009;22:122-9.

16. Cho ALS, Jeon SM, Kim MJ, et al. Chlorogenic zuur stelt anti-zwaarlijvigheidsbezit tentoon en verbetert lipidemetabolisme in high-fat dieet-veroorzaken-zwaarlijvige muizen. Voedsel Chem Toxicol. 2010;48(3):937-43.

17. Thom E. The-effect van chlorogenic zuur verrijkte koffie op glucoseabsorptie in gezonde vrijwilligers en zijn effect op lichaamsmassa wanneer gebruikte lange termijn in te zware en zwaarlijvige mensen. J Int. Med Res. 2007;35(6):900-8.

18. Van Dijk VE, Olthof-M., Meeuse JC, Seebus E, Heine RJ, van Dam RM. Scherpe gevolgen van cafeïnevrij gemaakte koffie en het belangrijkste chlorogenic zuur en trigonelline van koffiecomponenten voor glucosetolerantie. Diabeteszorg. 2009 Jun; 32(6): 1023-5.

19. Tunnicliffe JM, Eller LK, Reimer-Ra, Hittel DS, Shearer J. Chlorogenic zuur beïnvloedt glucose differentially na de maaltijd en glucose-afhankelijke insulinotropic polypeptidereactie bij ratten. Appl Physiol Nutr Metab. 2011 Oct; 36(5): 650-9.

20. Bidel S, HU G, Sundvall J, Kaprio J, Tuomilehto J. Effects van koffieconsumptie op glucosetolerantie, serumglucose en insulineniveaus: een analyse in dwarsdoorsnede. Horm Metab Onderzoek. 2006;38(1):38-43.

21. Johnston KL, Clifford-Mn, Morgan LM. De koffie wijzigt scherp gastro-intestinale hormoonafscheiding en glucosetolerantie in mensen: glycemic gevolgen van chlorogenic zuur en cafeïne. Am J Clin Nutr. 2003;78:728-33.

22. Rodriguez de Sotillo DV, Hadley T, Sotillo JE. Exon 11+/− wordt van de insulinereceptor uitgedrukt de ratten bij van Zucker (fa/fa), en chlorogenic zuur wijzigt hun van de plasmainsuline en lever proteïne en DNA. J Nutr Biochemie. 2006;7:63-71.

23. Arion WJ, Canfield-week, Ramos FC, et al. Chlorogenic zuur en hydroxynitrobenzaldehyde: nieuwe inhibitors van leverglucose 6 phosphatase. Boogbiochemie Biophys. 1997;339:315-22.

24. McCartymf. Een chlorogenic zuur-veroorzaakte stijging van glp-1 productie kan het effect bemiddelen van zware koffieconsumptie op diabetesrisico. Med Hypoth. 2004;64:848-53.

25. Henry-Vitrac C, Ibarra A, Rol M, Merillon JM, Vitrac X. Contribution van chlorogenic zuren aan de remming van menselijke lever glucose-6-phosphatase activiteit in vitro door Svetol, een gestandaardiseerd cafeïnevrij gemaakt groen koffieuittreksel. J Agric Voedsel Chem. 2010 14 April; 58(7): 4141-4.

26. Andrade-Cetto A, Vazquez RC. Gluconeogenesis remming en fytochemische samenstelling van twee Cecropia-species. J Ethnopharmacol. 2010 6 Juli; 130(1): 93-7.

27. Welsch CA, Lachance-PA, Wasserman BP. Dieet phenolic samenstellingen: remming van Na+- afhankelijk D-glucosebegrijpen in blaasjes van het de grensmembraan van de ratten de intestinale borstel. J Nutr. 1989;119(11):1698-704.

28. Vinson JA, Burnham-BR, Nagendran MV. De willekeurig verdeelde, dubbelblinde, placebo-gecontroleerde, lineaire dosis, de oversteekplaatsstudie om de doeltreffendheid te evalueren en de veiligheid van een groene koffieboon halen bij te zware onderwerpen. Diabetes Metab Syndr Obes. 2012;5:21-7.

29. Moriarty J, Branda M, Olsen Kerry, et al. De gevolgen van stijgende kosten om en zwaarlijvigheid op gezondheidszorgkosten onder volwassenen te roken: Een longitudinale studie van 7 jaar. J Occup omgeeft Med. 2012 Maart; 54(3): 286-91.

30. Poirier P, Eckel-relatieve vochtigheid. Zwaarlijvigheid en hart- en vaatziekte. Rep van Curratheroscler. 2002 Nov.; 4(6): 448-53.

31. Het gebied VE, Coakley EH, moet A, et al. Effect van overgewicht op het risico om gemeenschappelijke chronische ziekten tijdens een periode van 10 jaar te ontwikkelen. Med van de boogintern. 2001 9 Juli; 161(13): 1581-6.

32. Beschikbaar bij: http://patients.gi.org/topics/obesity/. Betreden 13 April, 2012.

33. Gr-Koofy NM, Anwar GM, lidstaten Gr-Raziky, et al. De vereniging van metabolisch syndroom, insulineweerstand en niet-alkoholische vettige leverziekte bij te zware/zwaarlijvige kinderen. Saoedi-arabisch J Gastroenterol. 2012 januari-Februari; 18(1): 44-9.

34. Zhang Y, Lee ET, Cowan LD, Fabsitz rr, Howard BV. Koffieconsumptie en de weerslag van type - diabetes 2 in mannen en vrouwen met normale glucosetolerantie: De sterke Hartstudie. Nutr Metab Cardiovasc Dis. 2011 Jun; 21(6): 418-23.

35. Greenberg JA, Boozer-CN, Geliebter A. Coffee, diabetes, en gewichtscontrole. Am J Clin Nutr. 2006;84:682-93.

36. Huxley R, Lee CM, Barzi F, et al. Koffie, cafeïnevrij gemaakte koffie, en theeconsumptie met betrekking tot inherent type - mellitus diabetes 2: een systematisch overzicht met meta-analyse. Med van de boogintern. 2009 14 Dec; 169(22): 2053-63.

37. Greenberg JA, Axen KV, Schnoll R, Boozer-CN. Koffie, thee en diabetes: de rol van gewichtsverlies en cafeïne. Int. J Obes Relat Metab Disord. 2005;29:1121-9.

38. van Dam RM, Willett-WC, Manson JE, FB van HU. Koffie, cafeïne, en risico van type - diabetes 2: een prospectieve cohortstudie in de jongere en op middelbare leeftijd vrouwen van de V.S. Diabeteszorg. 2006;29:398-403.

39. Wu T, Willett-WC, Hankinson-SE, Giovannucci E. Caffeinated koffie, cafeïnevrij gemaakte koffie, en cafeïne met betrekking tot plasma c-Peptide niveaus, een teller van insulineafscheiding, in de vrouwen van de V.S. Diabeteszorg. 2005;28:1390-6.

40. Loopstra-meesters RC, Liese-ADVERTENTIE, Haffner SM, Wagenknecht le, AJ Hanley. De verenigingen tussen de opname van caffeinated en maakten koffie en maatregelen van insulinegevoeligheid en bètacelfunctie cafeïnevrij. Diabetologia. 2011 Februari; 54(2): 320-8.

41. Bakuradze T, Boehm N, Janzowski C, et al. De anti-oxyderend-rijke koffie vermindert DNA-schade, heft glutathione status op en draagt tot gewichtscontrole: bij resultaten van een interventiestudie. Mol Nutr Food Res. 2011 Mei; 55(5): 793-7.

42. Onakpova I, Terry R, Ernst E. The-gebruik van groen koffieuittreksel als supplement van het gewichtsverlies: een systematische overzicht en een meta-analyse van willekeurig verdeelde klinische proeven. Gastroenterol Onderzoek Pract. 2011;2011.

43. Ishikawa A, Yamashita H, Hiemori M, et al. Karakterisering van inhibitors van hyperglycemie na de maaltijd van de bladeren van Nerium-indicum. J Nutr Sc.i Vitaminol. 2007 April; 53(2): 166-73.