De LenteUitverkoop van de het levensuitbreiding

Samenvattingen

Het Tijdschrift Juli 2012 van de het levensuitbreiding
Samenvattingen

Het groene uittreksel van de koffieboon

Chlorogenic zuur bevordert glucosevervoer in skeletachtige spier via AMPK-activering: een medewerker aan de gunstige gevolgen van koffie voor diabetes.

Chlorogenic zuur (CGA) is getoond om intestinale glucoseabsorptie te vertragen en gluconeogenesis te remmen. Ons doel was de rol van CGA in de verordening van glucosevervoer in skeletachtige die spier te onderzoeken van db/db-muizen wordt geïsoleerd en L6 skeletachtige spiercellen. De mondelinge die test van de glucosetolerantie werd op db/db-muizen uitgevoerd met CGA worden behandeld en de soleusspier werd geïsoleerd voor deoxyglucose 2 vervoerstudie. 2DG het vervoer werd ook onderzocht in L6 myotubes met of zonder inhibitors zoals wortmannin of de samenstelling c. AMPK werd neergehaald met AMPKα1/2 siRNA om zijn effect bij het CGA-Bevorderde glucosevervoer te bestuderen. OVERVLOED 4 translocatie, phosphorylation van AMPK en Akt, AMPK-activiteit, werd en vereniging van irs-1 en PI3K onderzocht in aanwezigheid van CGA. In db/db-muizen, werd een significante daling van het vasten bloedsuiker waargenomen 10 minuten na het intraperitoneal beleid van 250 mg/kg CGA en het effect duurde nog eens 30 minuten na de glucoseuitdaging voort. Bovendien, CGA bevorderde en verbeterde zowel basis als insuline-bemiddelde 2DG transporten in soleusspier. In L6 myotubes, veroorzaakte CGA een dosis en time-dependent verhoging van glucosevervoer. De samenstelling c en AMPKα1/2 siRNA schafte het CGA-Bevorderde glucosevervoer af. Verenigbaar met deze resultaten, CGA werd gevonden aan phosphorylate AMPK en ACC, verenigbaar met het resultaat van verhoogde AMPK-activiteiten. CGA scheen om geen vereniging van irs-1 met p85 te verbeteren. Nochtans, namen wij activering van Akt door CGA waar. Deze parallelle activering verhoogde op zijn beurt translocatie van OVERVLOED 4 tot plasmamembraan. Bij 2 mmol/l, veroorzaakte CGA geen significante veranderingen in uitvoerbaarheid of proliferatie van L6 myotubes. Onze gegevens toonden voor het eerst aan dat CGA glucosevervoer in skeletachtige spier via de activering van AMPK bevordert. Het blijkt dat CGA tot de gunstige gevolgen kan bijdragen van koffie voor Type - mellitus diabetes 2.

PLoS. 2012; 7(3): e32718

Caffeinated en cafeïnevrij gemaakte koffiegevolgen voor plasmalipoprotein cholesterol, apolipoproteins, en lipaseactiviteit: een gecontroleerde, willekeurig verdeelde proef.

De koffieconsumptie is geassocieerd met opgeheven plasmacholesterol. Honderd éénentachtig die mensen verbruikten een norm caffeinated koffie voor mo 2 door randomization wordt gevolgd verder te gaan caffeinated koffie (controle), verandering in cafeïnevrij gemaakte koffie of geen koffie voor mo 2. Van plasma laag-dichtheid-lipoprotein (LDL) de cholesterol en apolipoprotein B-de concentraties stegen beduidend (0.12 +/- 0.65 mmol/L, P minder dan 0.025; 0.06 +/- 0.12 g/L, P minder dan 0.0004, respectievelijk) in de groep die in cafeïnevrij gemaakte koffie veranderde. In een subgroep (n = 51), post-heparinelipoprotein verminderde de lipase beduidend meer (- 270 mmol vrije vetzuren. L-1.h-1, P minder dan 0.003) in de cafeïnevrij maken-koffiegroep. Het rustende harttarief en de bloeddruk veranderden niet beduidend. De verandering van caffeinated aan cafeïnevrij gemaakte koffie verhoogde plasmaldl cholesterol en apolipoprotein openbaarde B terwijl de beëindiging van koffie caffeinated geen verandering. Dit die het vinden stelt voor dat een koffiecomponent buiten cafeïne van de LDL-cholesterol, apolipoprotein B de oorzaak is, en de veranderingen van de lipaseactiviteit in dit onderzoek worden gemeld.

Am J Clin Nutr. 1991 Sep; 54(3): 599-605

Het remmende effect van het groene uittreksel van de koffieboon op vette accumulatie en het lichaamsgewicht bereiken in muizen.

ACHTERGROND: Een epidemiologische die studie in Italië wordt uitgevoerd wees erop dat de koffie de grootste anti-oxyderende capaciteit onder de algemeen verbruikte dranken heeft. De groene koffieboon is rijk aan chlorogenic zuur en zijn verwante samenstellingen. Het effect van het groene uittreksel van de koffieboon (GCBE) werd op vet accumulatie en lichaamsgewicht in muizen beoordeeld met de doelstelling om het effect te onderzoeken van GCBE op milde zwaarlijvigheid. METHODES: De mannelijke ddy muizen werden een standaarddieet gevoed dat GCBE en zijn belangrijkste constituenten, namelijk, cafeïne en chlorogenic zuur bevat, 14 dagen. Verder, werd het levertriglyceride (TG) niveau ook onderzocht na opeenvolgend beleid (13 dagen) van GCBE en zijn constituenten. Om het effect te onderzoeken van GCBE en zijn constituenten op vette absorptie, werden de serumtg veranderingen geëvalueerd in olijf olie-geladen muizen. Bovendien om het effect op levertg-metabolisme te onderzoeken, carnitine werd de palmitoyltransferase (CPT) activiteit in muizen geëvalueerd na opeenvolgende opname (6 dagen) van GCBE en zijn constituenten (cafeïne, chlorogenic zuur, neochlorogenic zuur en feruloylquinic zuur mengsel). VLOEIT voort: Men vond dat 0.5% en 1% GCBE diepgeworteld vetgehalte en lichaamsgewicht verminderden. De cafeïne en chlorogenic zuur toonden een tendens om diepgeworteld vet en lichaamsgewicht te verminderen. Mondeling beleid van GCBE (100 en 200 mg/kg. dag) 13 dagen getoond een tendens om levertg in muizen te verminderen. In hetzelfde model, chlorogenic zuur (60 mg/kg. dag) verminderd levertg-niveau. In muizen met olijfolie (5 mL/kg) worden geladen, verminderden GCBE (200 en 400 mg/kg) en de cafeïne (20 en 40 mg/kg) serumtg niveau dat. GCBE (1%), neochlorogenic zure (0.028% en 0.055%) en feruloylquinic zure mengsel (0.081%) verbeterden beduidend levercpt-activiteit in muizen. Nochtans, noch werd de cafeïne noch chlorogenic zuur alleen gevonden om CPT-activiteit te verbeteren. CONCLUSIE: Deze resultaten stellen voor dat GCBE tegen gewichtsaanwinst en vette accumulatie door remming van vette absorptie en activering van vet metabolisme in de lever misschien efficiënt is. De cafeïne werd gevonden om een ontstoringsapparaat van vette absorptie te zijn, terwijl chlorogenic zuur om gedeeltelijk in het onderdrukkende effect van GCBE werd gevonden worden geïmpliceerd dat in de vermindering van levertg-niveau resulteerde. Phenolic samenstellingen zoals neochlorogenic zuur en feruloylquinic zuur mengsel, behalve chlorogenic zuur, kunnen levercpt-activiteit verbeteren.

BMC-Med van Aanvullingsaltern. 2006 breng 17 in de war; 6:9

Koffiepolyphenols onderdrukken dieet-veroorzaakte lichaamsvetaccumulatie door downregulating SREBP-1c en verwante molecules in C57BL/6J-muizen.

Het overwicht van zwaarlijvigheid stijgt globaal, en de zwaarlijvigheid is een groot risicofactor voor type - diabetes 2 en hart- en vaatziekte. Wij onderzochten de gevolgen van koffiepolyphenols (CPP), die overvloedig in koffie zijn en wereldwijd verbruikt, op dieet-veroorzaakte lichaamsvetaccumulatie. C57BL/6J die de muizen werden of een controledieet, een high-fat dieet, of een high-fat dieet gevoed met 0.5 tot 1.0% CPP 2-15 weken wordt aangevuld. De aanvulling met CPP verminderde lichaamsgewichtaanwinst, beduidend buik en lever vette accumulatie, en infiltratie van macrophages in vetweefsels. De energieuitgaven door indirecte calorimetrie worden geëvalueerd werden beduidend verhoogd in CPP-Gevoede muizen die. De mRNA niveaus van sterol regelgevende element-bindende proteïne (SREBP) - 1c, acetyl-CoA carboxylase-1 en -2, stearoyl-CoA desaturase-1, en pyruvate dehydrogenase kinase-4 in de lever waren beduidend lager in CPP-Gevoede muizen dan in high-fat controlemuizen. Op dezelfde manier onderdrukte CPP de uitdrukking van deze molecules in Hepa 1-6 cellen, samengaand met een verhoging van microRNA-122. De structuur-activiteit verhoudingsstudies van negen quinic zure die derivaten van CPP in Hepa 1-6 cellen worden geïsoleerd suggereerden dat de mono of Di-caffeoyl quinic zuren (CQA) werkzamee stoffen in de gunstige gevolgen van CPP zijn. Voorts verminderden CPP en 5-CQA de kern actieve vorm van srebp-1, carboxylase acetyl-CoA activiteit, en cellulaire niveaus malonyl-CoA. Deze bevindingen wijzen erop dat CPP energiemetabolisme verbetert en lipogenesis door downregulating SREBP-1c en verwante molecules vermindert, die tot de afschaffing van lichaamsvetaccumulatie leidt.

Am J Physiol Endocrinol Metab. 2011 Januari; 300(1): E122-33

De modulerende gevolgen van chlorogenic zuur voor lipiden en glucosemetabolisme en de uitdrukking van lever peroxisome proliferator-geactiveerde receptor-alpha- in gouden hamsters voedden op hoogte - vet dieet.

DOELSTELLING: Om de gevolgen te onderzoeken van chlorogenic zuur (CGA) voor lipide en glucosemetabolisme onder een hoge dieetvetlast en de mogelijke rol van peroxisome proliferator-geactiveerde receptor-alpha- (PPAR-Alpha-) in deze gevolgen te onderzoeken. METHODES: Twintig mannelijke gouden hamsters werden willekeurig verdeeld in CGA-behandelingsgroep (n=10, gezien buikvliesdieinjectie van CGA-oplossing met PBS, 80 mg van CGA/kg wordt voorbereid het lichaamsgewicht dagelijks), en controlegroep (n=10, gezien PBS i.p. bij het gemiddelde volume van de behandelingsgroep). De dieren in beide groepen werden gegeven hoge 15% - vet dieet. Acht weken nadat de behandeling met CGA, het niveau van biochemische parameters in het vasten serum en weefsels en de uitdrukking van levermrna en eiwit PPAR-Alpha- werden bepaald. VLOEIT voort: Acht weken na behandeling met CGA, de niveaus van het vasten serumtriglyceride (TG), vrij vetzuur (FFA), totale cholesterol (TC), lage dichtheidslipoprotein cholesterol (ldl-c), hoog - dichtheidslipoprotein de cholesterol (hdl-c), de glucose (FSG), en de insuline (FSI) waren beduidend lager in de GGA-behandelingsgroep dan in de controlegroep. CGA leidde ook tot hogere activiteit van leverlipase (HL), lagere inhoud van TG en FFA in lever, en lagere activiteit van lipoprotein lipase (LPL) in skeletachtige spier. Beduidend opgeheven voorts CGA beduidend opgeheven het uitdrukkingsniveau van mRNA en eiwituitdrukking in lever PPAR-Alpha-. CONCLUSIE: CGA kan lipiden en glucosemetabolisme wijzigen, die aan PPAR-Alpha- vergemakkelijkte lipideontruiming in lever en betere insulinegevoeligheid kunnen worden toegeschreven.

Biomed omgeeft Sc.i. 2009 April; 22(2): 122-9

Chlorogenic zuur stelt anti-zwaarlijvigheidsbezit tentoon en verbetert lipidemetabolisme in high-fat dieet-veroorzaken-zwaarlijvige muizen.

Deze studie onderzocht de doeltreffendheid van chlorogenic zuur op veranderend lichaamsvet in high-fat dieet (37% calorieën van vet) veroorzaken-zwaarlijvige muizen in vergelijking met caffeic zuur. Caffeic zure of chlorogenic zuur werd aangevuld met high-fat dieet bij 0.02% dosis (van wt/wt). Zowel caffeic zure als chlorogenic zuur lichaamsgewicht, beduidend diepgewortelde vette massa en plasmaleptin en insulineniveaus verminderde in vergelijking met de high-fat controlegroep. Zij verminderden ook triglyceride (in plasma, lever en hart) en cholesterol (in plasma, vetweefsel en hart) concentraties. De triglycerideinhoud in vetweefsel werd beduidend verminderd, terwijl het niveau van plasmaadiponectin door chlorogenic zure aanvulling in vergelijking met de high-fat controlegroep werd opgeheven. Het lichaamsgewicht werd beduidend gecorreleerd met plasmaleptin (r=0.894, p<0.01) en insuline (r=0.496, p<0.01) niveaus, respectievelijk. Caffeic zure en chlorogenic zuur verbood beduidend vetzuursynthase, 3 reductase van hydroxy-3-methylglutarylcoa en acyl-CoA: de activiteiten van cholesterolacyltransferase, terwijl zij de activiteit van de vetzuur bèta-oxydatie en peroxisome proliferator-geactiveerde receptoren alpha- uitdrukking in de lever in vergelijking met de high-fat groep verhoogden. Deze resultaten stellen voor dat caffeic zure en chlorogenic zuur lichaamsgewicht, lipidemetabolisme en op zwaarlijvigheid betrekking hebbende hormonenniveaus in high-fat gevoede muizen verbetert. Chlorogenic zuur scheen meer machtig voor lichaamsgewichtvermindering en regelgeving van lipidemetabolisme te zijn dan caffeic zuur.

Voedsel Chem Toxicol. 2010 breng in de war; 48(3): 937-43

Overgewicht, zwaarlijvigheid, en mortaliteit in een grote prospectieve cohort van personen 50 tot 71 jaar oud.

ACHTERGROND: Zwaarlijvigheid, door een lichaam-massa index (BMI) wordt de bepaald (het gewicht in kilogram door het vierkant van de hoogte in meters wordt verdeeld) wordt van 30.0 of meer, geassocieerd met een verhoogd risico van dood, maar de relatie tussen overgewicht (een BMI van 25.0 tot 29.9) is en het risico van dood die gevraagd. METHODES: Wij onderzochten voor de toekomst BMI met betrekking tot het risico van dood door om het even welke oorzaak in 527.265 mannen en de vrouwen van de V.S. in de Nationale Instituten van cohort gezondheid-AARP die 50 tot 71 jaar oud bij inschrijving in 1995-1996 waren. BMI werd berekend vanaf zelf-gerapporteerde gewicht en hoogte. De relatieve risico's en de 95 percentenbetrouwbaarheidsintervallen werden aangepast leeftijd, ras of etnische groep, niveau van onderwijs, het roken status, fysische activiteit, en alcoholopname. Wij leidden ook alternatieve analyses om potentiële biases te richten met betrekking tot reeds bestaande chronische ziekte en het roken status. VLOEIT voort: Tijdens een maximumfollow-up van 10 jaar door 2005, stierven 61.317 deelnemers (42.173 mannen en 19.144 vrouwen). De aanvankelijke analyses toonden een verhoogd risico van dood voor de hoogste en laagste categorieën van BMI onder zowel mannen als vrouwen, in alle rassen of etnische groepen, en op alle leeftijden. Toen de analyse werd beperkt tot gezonde mensen die nooit hadden gerookt, werd het risico van dood geassocieerd met zowel overgewicht als zwaarlijvigheid onder mannen en vrouwen. In analyses van BMI tijdens middelbare leeftijd (leeftijd van 50 jaar) onder zij die nooit hadden gerookt, werden de verenigingen sterker, met het risico van dood die met 20 tot 40 percenten onder te zware personen stijgen en door twee aan minstens drie keer onder zwaarlijvige personen; het risico van dood onder te lichte personen werd verminderd. CONCLUSIES: Het bovenmatige lichaamsgewicht tijdens middelbare leeftijd, met inbegrip van overgewicht, wordt geassocieerd met een verhoogd risico van dood.

N Engeland J Med. 2006 24 Augustus; 355(8): 763-78

Zwaarlijvigheid als ziekte: geen lichtgewichtkwestie.

De epidemische stijging van zwaarlijvigheid heeft het huidige debat over zijn classificatie als ziekte van brandstof voorzien. Het tegendeel aan enkel het zijn een medische voorwaarde of risicofactor voor andere ziekten, zwaarlijvigheid is een complexe ziekte van veelzijdige etiologie, met zijn eigen onbruikbaar makende capaciteiten, pathophysiologies en comorbidities. Het ontmoet de medische definitie van ziekte in zoverre dat het een fysiologische dysfunctie van het menselijke organisme met milieu, genetische en endocrinologische etiologie is. Het is een reactie op milieustimuli, genetische neiging en abnormaliteiten, en heeft een kenmerkende reeks tekens en symptomen met verenigbare anatomische wijzigingen. Het bovenmatige vetweefsel verhoogt het werk van het hart en leidt tot anatomische veranderingen in dit orgaan. Het verandert long, endocriene en immunologische functies, allen met nadelige gevolgen op gezondheid. Enkele complicaties van zwaarlijvigheid omvatten hart- en vaatziekte, niet-insuline-afhankelijke diabetes mellitus, obstructieve longziekte, artritis en kanker. Gezien de bovenmatige mortaliteit, de wezenlijke morbiditeit en de economische tol van zwaarlijvigheid, is dit een ziekte die ernstige aandacht door de medische gemeenschap rechtvaardigt. De status en de goedkeuring van de zwaarlijvigheid als ziekte zijn centraal in het bepalen van zijn behandeling, terugbetaling voor behandeling en de ontwikkeling van wijdverspreide acties.

Augustus van Obes toer 2004; 5(3): 145-51

Effect van caloriebeperking met of zonder oefening op insulinegevoeligheid, bèta-celfunctie, vette celgrootte, en ectopisch lipide bij te zware onderwerpen.

DOELSTELLING: Het doel van dit artikel was de verhoudingen onder totaal lichaamsvet, diepgeworteld vetweefsel (de BTW), vette celgrootte (FCS), ectopisch vet deposito in lever (intrahepatic lipide [IHL]) en spier (intramyocellular lipide [IMCL]), en de index van de insulinegevoeligheid te bepalen (S (I)) in gezonde te zware, glucose-verdraagzame onderwerpen en de gevolgen van caloriebeperking door dieet alleen of samen met oefening op deze variabelen. ONDERZOEKontwerp EN METHODES: Achtenveertig te zware vrijwilligers werden willekeurig toegewezen aan vier groepen: de controle (100% van energiebehoeften), 25% de caloriebeperking (Cr), 12.5% caloriebeperking +12.5% energieuitgaven door gestructureerde oefening (CREX), of 15% het gewichtsverlies door een low-calorie dieet volgden in gewicht onderhoud 6 maanden (LCD). Het gewicht, de percenten lichaamsvet, de BTW, IMCL, IHL, FCS, en S (I) werden beoordeeld bij basislijn en maand 6. VLOEIT voort: Bij basislijn, werd FCS betrekking gehad op de BTW en IHL (P < 0.05) maar niet op IMCL. FCS was ook de sterkste determinant van S (I) (P < 0.01). Het gewichtsverlies bij maand 6 was 1 +/- 1% (controle, gemiddelde +/- SE), 10 +/- 1% (Cr), 10 +/- 1% (CREX), en 14 +/- 1% (LCD). De BTW, FCS, de percenten lichaamsvet, en IHL werden verminderd in de drie interventiegroepen (P < 0.01), maar IMCL was onveranderd. S (I) werd verhoogd bij maand 6 (P = 0.05) in CREX (37 +/- 18%) en LCD (70 +/- 34%) groepen (P < 0.05) en neigde om in de Cr-groep (40 +/- 20%, P = 0.08) te stijgen. Samen werden de verbeteringen van S (I) betrekking gehad op verlies in gewicht, vette massa, en de BTW, maar niet IHL, IMCL, of FCS. CONCLUSIES: Grote adipocytes leiden tot lipidedeposito in diepgewortelde en leverweefsels, bevorderend insulineweerstand. De caloriebeperking door dieet alleen of met oefening keert deze tendens om.

Diabeteszorg. 2006 Jun; 29(6): 1337-44

Kinetisch analyse en mechanisme op de remming van chlorogenic zuur en zijn componenten tegen varkensalvleesklieralpha-amylase isozymes I en II.

Chlorogenic zuur (5-caffeoylquinic zuur, 5-CQA) is een soort polyphenol en is rijk inbegrepen in groene koffiebonen. De remmende gevolgen van 5-CQA en zijn componenten, caffeic zuur (CA) en quinic zuur (QA), voor twee varkensalvleesklieralpha-amylase (PPA) werden isozymes, ppa-I en ppa-II, onderzocht gebruikend p-nitrophenyl-alpha--D-maltoside als substraat bij pH 6.9 en 30 graden van C. De remmingskracht van de respectieve inhibitors tegen beide PPA-isozymes was bijna hetzelfde en in de orde van 5-CQA > QA van CA >>. 50) waarden hun van IC (waren 0.07-0.08 mm, 0.37-0.40 mm, en 25.3-26.5 mm, respectievelijk. De remmingsmechanismen van 5-CQA en CA werden onderzocht door kinetische analyses, en de inhibitorconstanten K (I) en K (I) '(voor het vrije complexe enzym en enzyme-substrate, respectievelijk) werd bepaald. Men wees erop dat 5-CQA en CA de remming van het gemengde type met K (I) > K (I) 'tegen zowel ppa-I als ppa-II toonden. De band van ppa-I of ppa-II met 5-CQA of CA was exotherm en enthalpie-gedreven allen. QA is een slechte inhibitor, en zijn remmende wijze was uniek en nauwelijks geanalyseerd door eenvoudige een michaelis-Menten-Type interactie tussen het enzym en de inhibitor. Nochtans, toonde men dat de remmende activiteit van CA 5 keer door ester-band vorming met QA in de vorm van 5-CQA werd verbeterd. Deze resultaten voorzien ons van significante wenken voor de ontwikkeling van alpha-amylase inhibitors nuttig voor de preventie van diabetes en zwaarlijvigheid.

J Agric Voedsel Chem. 2009 14 Oct; 57(19): 9218-25