Het Bloedonderzoek Super Verkoop van de het levensuitbreiding

Samenvattingen

Vitamine B6: 457 onderzoeksamenvattingen

Het Laboratoriummed van Clinchem. 2002 Februari; 40(2): 137-42.

De nierfunctie oefent slechts een minder belangrijke invloed op hoge plasmahomocysteine concentraties in patiënten met scherpe coronaire syndromen uit.

Jonasson T, Ohlin H, Andersson A, Arnadottir M, Hultberg B.

Afdeling van Geneeskunde, Universiteit van Lund, het Universitaire Ziekenhuis, Zweden. torfi.jonasson@kard.lu.se

Men heeft voorgesteld dat hyperhomocysteinemia in patiënten met occlusieve vaatziekte wordt waargenomen door verminderde nierfunctie secundair aan renovascular ziekte die wordt veroorzaakt. Wij hebben daarom serumcystatin C, een nieuwe gevoelige teller voor kluwenvormige filtratie, in 59 patiënten met scherpe coronaire syndromen en hoge plasmahomocysteine (tHcy) concentratie gebruikt om nierfunctie te meten. De steekproeven werden ook verkregen uit 34 patiënten met laag-normale plasmathcy en 50 controleonderwerpen. De patiënten met de laag-normale concentratie van plasmathcy toonden verminderde concentraties van serumcystatin C en serumcreatinine en verhoogden concentraties van bloedfolate en serumcobalamin in vergelijking met de controles en bij de patiënten met hoge plasmathcy. Er was een grote overlapping in cystatinc concentraties tussen patiënten met hoge en laag-normale plasmathcy. Geen van de parameters behalve plasmathcy was worden onderzocht beduidend verschillend in de groep patiënten met de hoge concentratie van plasmathcy in vergelijking met de controlegroep die. om het belang van nierstoornis verder aan te tonen, werd een subgroep van de patiënten met hoge plasmathcy aangevuld dagelijks met folic zure 5 mg, pyridoxine 40 mg en cyancobalamin 1 mg 3 maanden. De vitaminetherapie verminderde plasmathcy van 18.3+/4.6 pmol/l tot 9.6+/2.2 pmol/l (p<0.0001). Nochtans, versterkte de vitaminebehandeling niet de correlatie tussen cystatin C en de concentraties van plasmathcy. Deze bevindingen steunen niet de hypothese dat de subtiele nierdysfunctie een belangrijke oorzaak van de hoge concentratie van plasmathcy in patiënten met scherpe coronaire syndromen is.

J Nutr Sc.i Vitaminol (Tokyo). 2002 Februari; 48(1): 10-7.

Vitamineb6 status van de borst gegeven zuigelingen met betrekking tot pyridoxinehcl aanvulling van moeders.

Chang SJ, Kirksey A.

Ministerie van Biologie, Nationaal Cheng Kung University, Tainan, Taiwan, ROC.

De vitamine B6 nutritue van de borst gegeven zuigelingen werd geëvalueerd door vitamineb6 opname, plasmapyridoxal 5 ' - phosphate de concentratie (van PLP), en de groeipatronen tijdens mo eerst 6 van de zuigelingen van leeftijd. De vitamineb6 opnamen van 47 gezond, term zuigelingen werden beduidend gecorreleerd met vier niveaus van moedervitamineb6 supplementen: 2.5, 4.0, 7.5, of 10.0 mg pyridoxine (PN) HCl/d en ontmoet de B6 Adequate Opname (AI, 1998) van 0.1 mg/d voor zuigelingenmo 0 tot 6. Slechts de zuigelingen de van wie moeders 10.0 mg PN x HCl/d ontvingen overschreden of ontmoetten de Geadviseerde Dieettoelagen (RDA, 1989) van 0.3 mg-vitamine B6/d van 4 tot mo 6 van leeftijd. De plasmaplp concentraties van zuigelingen, bij mo 1, 4, en 6 van leeftijd worden gemeten vergeleken de vitamineb6 opname die van hun moeder. De meeste zuigelingen toonden de normale groei. De bevindingen wezen erop dat moeder PN x HCl supplement van 2.5 mg/d een adequate hoeveelheid vitamine B6 in moedermelk (0.15 mg/d) voor de parameters van de vitamineb6 status en de groei van de borst gegeven zuigelingen verstrekte.

J Nutr Sc.i Vitaminol (Tokyo). 2002 Februari; 48(1): 65-8.

De dieetvitamine B6 onderdrukt dubbelpunttumorigenesis, hydroxyguanosine 8, hydroxynonenal 4, en de afleidbare salpeterproteïne van oxydesynthase in azoxymethane-behandelde muizen.

KOMATSU S, Watanabe H, Oka T, Tsuge H, Kat N.

Faculteit van Toegepaste Biologische Wetenschap, de Universiteit van Hiroshima, higashi-Hiroshima, Japan.

Onlangs rapporteerden wij dat de aanvulling van vitamine B6 aan laag vitamineb6 dieet afschaffing in dubbelpunttumorigenesis en celproliferatie van azoxymethane-behandelde muizen op een dose-dependent manier onder 1, 7, en 14 mg-pyridoxinehcl/kg dieet veroorzaakte (J. Nutr. 131: 2204-2207, 2001). Om het mechanisme van het effect van de anticolontumor van vitamine B6 te onderzoeken, werden de mannelijke ICR-muizen gevoed het dieet die 1, 7, 14, en 35 mg-pyridoxinehcl/kg bevatten dieet 22 weken en werden gelijktijdig gegeven een wekelijkse injectie van azoxymethane voor eerste 10 weken. De aanvulling van vitamine B6 aan een laag vitamineb6 dieet (1 mg pyridoxinehcl/kg) onderdrukte de niveaus van hydroxyguanosine 8 en hydroxynonenal 4 van de dikke darm en de afleidbare salpeterproteïne van oxydesynthase. De resultaten stellen voor dat het preventieve die effect van vitamine B6 tegen dubbelpunttumorigenesis op zijn minst voor een deel is door oxydatieve spanning en salpeteroxydeproductie te verminderen wordt bemiddeld.

Osteoartritiskraakbeen. 2002 Februari; 10(2): 119-26. De dieetvitaminen en het selenium verminderen de ontwikkeling van mechanisch veroorzaakt osteoartritis en verhogen de uitdrukking van antioxidative enzymen in de knieverbinding van STR/1N-muizen.

Kurz B, Jost B, Schunke M.

Anatomisches Institut der CAU zu Kiel, Olshausenstr. 40, Kiel, Duitsland. bkurz@anat.uni-kiel.de

DOELSTELLING: Om de invloed van dieetvitaminen en selenium op mechanisch-veroorzaakt osteoartritis (OA) en de uitdrukking van antioxidative enzymen in de mannelijke muizen van STR/1N te bestuderen en Balb/c-. De mannelijke STR/1N-muizen zijn naar voren gebogen die OA te ontwikkelen door een varus misvorming-veroorzaakte mechanische overbelasting van het middel tibial plateau wordt veroorzaakt. METHODES: Na 12 maanden van het voeden van (speciaal die dieet met de vitaminen E, C, A, B6, B2, en selenium wordt aangevuld) periodieke histologische secties van de knie werden de verbindingen geëvalueerd voor ontwikkeling van osteoarthritic veranderingen (rang 0-4). Serumglutathione de peroxidaseactiviteit (GSH -GSH-px) werd fotometrisch gemeten. De uitdrukking van antioxidative enzymen werd aangetoond door immunohistochemistry. VLOEIT voort: Alle controlestr/1n muizen toonden OA-letsels (rang 3-4) terwijl het speciale dieet OA-neer weerslag beduidend aan ongeveer 65% verminderde (meestal rang 2). Zelfs in Balb/c-muizen was de weerslag verminderd door het speciale dieet van ongeveer 21% (controledieren; rang 1) aan ongeveer 14%. De activiteit van serumgsh -gsh-px steeg dieet-dependently in beide muisspanningen maar was over het algemeen hoger in Balb/c-muizen. In beide muisspanningen verhoogde het speciale dieet de uitdrukking van GSH -GSH-px en cu/Zn-Zode in gewrichtskraakbeen terwijl er geen uitdrukking van Mn-Zode was. Er was ook een speciale dieet-afhankelijke verhoging van uitdrukking van GSH -GSH-px in synovium van beide muisspanningen terwijl een verhoging van uitdrukking van Mn-Zode en cu/Zn-Zode slechts in synovium van STR/1N-muizen kon worden gezien. CONCLUSIES: Een dieet met vitaminen/selenium wordt aangevuld zou in preventie of therapie van mechanisch veroorzaakt OA belangrijk kunnen zijn dat. Wij stellen een hypothese op dat de vrije zuurstof radicale species in de mechanische inductie van OA zouden kunnen worden geïmpliceerd. Internationale de Maatschappij van het het Osteoartritisonderzoek van Copyright 2002.

Pediatr Neurol. 2002 Februari; 26(2): 146-7. Pyridoxal fosfaat-ontvankelijke epilepsie met weerstand tegen pyridoxine.

Kuomf, Wang HS.

Afdeling van Pediatrische Neurochirurgie, Afdeling van Chirurgie, het Nationale Universitaire Ziekenhuis van Taiwan, Taipeh, Taiwan.

Wij stellen een vrouwelijke zuigeling met beslagleggingen ontvankelijk voor pyridoxal fosfaat voor maar dat is bestand tegen pyridoxine. Het mechanisme waardoor pyridoxal het fosfaat beslagleggingen in deze patiënt controleert is onbekend. Haar beslagleggingen worden misschien niet alleen veroorzaakt door pyridoxal fosfaatdeficiëntie. Men stelt voor dat naast glutamic zuurdecarboxylase abnormaliteit, de weg van de absorptie, het vervoer, phosphorylation, en de oxydatie van pyridoxine aan pyridoxal fosfaat in deze patiënt gebrekkig zou kunnen zijn. Het zou moeten worden overwogen of pyridoxal het fosfaat de drug van keus in plaats van pyridoxine kan zijn in het behandelen van patiënten verondersteld van pyridoxine-afhankelijke epilepsie om mislukkingstarief en verdere vertraging in beslagleggingscontrole te verlagen.

Pediatrie. 2002 Februari; 109(2): 325-7. De vergiftiging van het Ginkgozaad.

Kajiyama Y, Fujii K, Takeuchi H, Manabe Y.

Afdeling van Pediatrie Kyoto min-I het Centrale Ziekenhuis Kyoto, Japan. yo-f@dab.hi-ho.ne.jp

Een 2 die éénjarigenmeisje met het braken en diarree 7 uren na het eten van een grote hoeveelheid ginkgozaden wordt voorgesteld. Zij stelde een koortsvrije uitbarsting 9 uren na opname tentoon. De serumconcentratie van metoxypyridoxine 4 was zo hoog zoals 360 ng/mL. Hoewel de gemelde gevallen van de vergiftiging van het ginkgozaad gewoonlijk kinderen impliceren die herhaalde beslagleggingen tentoonstellen die fataal kunnen zijn, kan het snelle beleid van pyridoxal fosfaat (2 mg/kg) extra beslagleggingen verhinderd hebben. Dit is het eerste Engelstalige gevalrapport die 4 metoxypyridoxineconcentratie meten tijdens de vergiftiging van het ginkgozaad. De voorlichting van het potentiële gevaar van overconsumptie van dit traditionele voedsel en zijn snelle behandeling met pyridoxal fosfaat kan terugwinning verhaasten.

De Vaardigheden van Perceptmot. 2002 Februari; 94(1): 135-40.

Gevolgen van pyridoxine bij het dromen: een voorbereidende studie.

Ebben M, Lequerica A, Spielman A.

Stadsuniversiteit van New York, de V.S.

Het effect van pyridoxine (Vitamine B-6) werd bij het dromen in een placebo, dubbelblinde studie onderzocht om diverse eisen dat te onderzoeken Vitamine B-6 droomvividness of de capaciteit verhoogt om aan dromen te herinneren. 12 studenten namen aan alle drie behandelingsvoorwaarden deel, elk waarvan het opnemen van of 100 mg B-6, 250 mg B-6, of een placebo voorafgaand aan bedtijd voor een periode van vijf opeenvolgende dagen impliceerde. De behandelingsvoorwaarden werden volledig gecompenseerd en een tweedaagse wegspoelingsperiode kwam tussen de drie vijfdaagse behandelingsblokken voor. De ochtend zelf-rapporten wezen op een significant verschil in droom-salience scores (dit is een samengestelde score die maatregelen op vividness, bizarreness, emotionality, en kleur bevatten) tussen de 250 mg-voorwaarde en de placebo in de loop van de eerste drie dagen van elke behandeling. De gegevens voor droomsalience stellen voor dat Vitamine B-6 kan handelen door corticaal ontwaken tijdens periodes van slaap de snelle van de vooravondbeweging (rem) te verhogen. Een hypothese wordt voorgesteld implicerend de rol van B-6 in de omzetting van tryptofaan aan serotonine. Nochtans, moet deze eerste studie worden herhaald en gebruikend dezelfde procedures ook in een slaaplaboratorium worden aangetoond alvorens resultaten kunnen als zekere worden beschouwd.

Semin Neonatol. 2002 Februari; 7(1): 17-26. Beheer en noodsituatiebehandelingen van pasgeborenen met een verdenking van ingeboren fouten van metabolisme.

Ogier de Baulny H.

Neurologie en Metabolische Ziekteneenheid, Hopital Robert Debre, Parijs, Frankrijk. helene.ogier@rdb.ap-hop-paris.fr

Tijdens de periode bij pasgeborenen, ingeboren fouten van metabolisme meestal huidig met een overweldigende ziekte die snelle diagnose en zowel steunende als specifieke behandelingen vereist. De frequentste situaties zijn toe te schrijven aan branched-chain organische acidurias die met ketoacidosis en ureumcyclustekorten voorstellen die door hyperammonaemia worden gekenmerkt. Tijdens zowel situaties, zijn de procedures van de toxineverwijdering als de voedingssteun met een vrij-eiwit en high-energy dieet centrale behandelingen. In patiënten die met hypoglycaemie voorstellen moeten de niveaus van de bloedglucose worden verbeterd. De vooruitgang na glucosevoorziening is nuttig in het erkennen van de wanorde die hoofdzakelijk wordt betrokken. Hyperinsulinism vereist hoog-glucoseinfusie. De ziekten van de glycogeenopslag en gluconeogenesis de tekorten worden gemakkelijk behandeld met een permanente glucosevoorziening terwijl hypoglycaemias snel terugkomen. In patiënten met galactosaemia, worden de erfelijk fructoseonverdraagzaamheid of tyrosinaemiatype I, de presentatie door een levermislukking overheerst die galactose en fructoseuitsluiting verbonden aan een low-protein dieet vereisen. Vele patiënten met bèta-oxydatietekorten kunnen met hypoglycaemie voorstellen die gewoonlijk gemakkelijk wordt verbeterd. De nauwkeurige diagnose kan gemakkelijk in die patiënten worden gemist die doen goed in de volgende weken maar hartmislukking, aritmie en/of levermislukking kunnen ontwikkelen. De patiënten die met hardnekkige uitbarstingen, vitamineontvankelijkheid aan biotine voorstellen, pyridoxine en folate moeten worden overwogen. Copyright 2002 Elsevier Science Ltd. Alle voorgebe*houde rechten.

Toer 2002 van Syst van het Cochranegegevensbestand; (1): CD000145.

Commentaar in: • De Club van ACS J. 2002 sep-Oct; 137(2): 67.

Update van: • Toer 2000 van Syst van het Cochranegegevensbestand; (2): CD000145.

Acties voor misselijkheid en het braken in vroege zwangerschap.

Jewell D, Young G.

Afdeling van Primaire Gezondheidszorg, Universiteit van Bristol, Canynge-Zaal, Whiteladies-Road, Bristol, het UK. david.jewell@bristol.ac.uk

ACHTERGROND: De misselijkheid en het braken zijn de gemeenschappelijkste symptomen ervoeren in vroege zwangerschap, met misselijkheid die tussen 70 en 85% van vrouwen beïnvloeden. De helft ongeveer van het zwangere vrouwenervaring braken. DOELSTELLINGEN: De doelstelling van dit overzicht was de gevolgen van andere methoden te beoordelen om misselijkheid te behandelen en in vroege zwangerschap te braken. ONDERZOEKSstrategie: Wij zochten het de Zwangerschap en de Bevallingsregister van Groepsproeven van Cochrane en Cochrane controleerde Proevenregister. Datum van laatste onderzoek: Oktober 2001. SELECTIEcriteria: Willekeurig verdeelde proeven van om het even welke behandeling voor misselijkheid en/of het braken in vroege zwangerschap. GEGEVENSVERZAMELING EN ANALYSE: De proefkwaliteit werd beoordeeld en de gegevens werden gehaald onafhankelijk door twee recensenten. DE LEIDING VLOEIT VOORT: Drieëntwintig proeven waren inbegrepen. Deze proeven waren van veranderlijke kwaliteit. De misselijkheidsbehandelingen waren verschillende anti-histamine medicijnen, vitamine B6 (pyridoxine), de combinatietablet Debendox (Bendectin) en P6 acupressure. Voor hyperemesisgravidarum waren vijf proeven geïdentificeerde testende behandelingen met het mondelinge uittreksel van de gemberwortel, mondelinge corticosteroids of spoten adrenocorticotropic hormoon (ACTH) en intraveneuze diazepam in. Gebaseerd op 13 proeven, was er een algemene vermindering van misselijkheid van anti-emetic medicijn (kansenverhouding 0.17, 95% betrouwbaarheidsinterval 0.13 tot 0.21). DE CONCLUSIES VAN DE RECENSENT: Anti-emetic medicijn schijnt om de frequentie van misselijkheid in vroege zwangerschap te verminderen. Er is wat bewijsmateriaal van nadelige gevolgen, maar er is zeer weinig informatie over gevolgen voor foetale resultaten van willekeurig verdeelde gecontroleerde proeven. Van nieuwere behandelingen, schijnt het pyridoxine (vitamine B6) efficiënter te zijn in het verminderen van de strengheid van misselijkheid. De resultaten van proeven van P6 acupressure zijn dubbelzinnig. Geen proeven van behandelingen voor hyperemesisgravidarum tonen om het even welk bewijsmateriaal van voordeel. Het bewijsmateriaal van waarnemingsstudies stelt geen bewijsmateriaal van teratogenicity van om het even welk van deze behandelingen voor.

J Clin Psychiatrie. 2002 Januari; 63(1): 54-8.

Vitamine B6 als randbehandeling in chronische schizofrene en schizoaffective patiënten: een dubbelblinde, placebo-gecontroleerde studie.

Lerner V, Miodownik C, Kaptsan A, Cohen H, Loewenthal-U, Kotler M.

Ministerie van volksgezondheid Geestelijk Gezondheidscentrum, Faculteit van Gezondheidswetenschappen, ben-Gurion Universiteit van Negev, be'er-Sheva, Israël. lernervld@yahoo.com

ACHTERGROND: De vitamine B6, of het pyridoxine, spelen een intrinsieke rol in de synthese van bepaalde neurotransmitters die aan ontwikkeling van psychotische staten deelnemen. Verscheidene rapporten wijzen erop dat de vitamine B6 een factor in een aantal psychiatrische wanorde en verwante voorwaarden, zoals autisme, de ziekte van Alzheimer, hyperactiviteit, het leren onbekwaamheid, bezorgdheidswanorde, en depressie kan zijn. Voorts zijn er anecdotische rapporten van een vermindering van psychotische symptomen na vitamineb6 aanvulling van psychopharmacologic behandeling van patiënten die aan schizofrenie of organische geestelijke wanorde lijden. Het doel van deze studie was te onderzoeken of de vitamineb6 therapie psychotische symptomen in patiënten beïnvloedt die aan schizofrenie en schizoaffective wanorde lijden. METHODE: De gevolgen van de aanvulling van vitamine B6 aan antipsychotic behandeling op positieve en negatieve symptomen in 15 schizofrene en schizoaffective patiënten (dsm-IV criteria) werden onderzocht in dubbelblind, placebo-gecontroleerd, oversteekplaatsstudie die 9 weken overspannen. Alle patiënten hadden stabiele psychopatologie minstens 1 maand vóór ingang in de studie en werden gehandhaafd bij de behandeling met hun prestudy psychoactieve en antiparkinsonian medicijnen door de studie. Alle patiënten werden beoordeeld gebruikend het Positief en verbieden Syndroomschaal (PANSS) wekelijks voor schizofrenie. De patiënten ontvingen placebo of vitamine B6 die, die bij 100 mg/dag in de eerste week beginnen en tot 400 mg/dag in de vierde week met 100 mg-toename willekeurig stijgen elke week. VLOEIT voort: PANSS-scores openbaarden geen verschillen tussen vitamine B6- en placebo-behandelde patiënten in verbetering van hun geestelijke staat. CONCLUSIE: De verdere studies met grotere bevolking en kortere duur van ziekte zijn nodig om de kwestie van de mogelijke doeltreffendheid van vitamine B6 in behandeling van psychotische symptomen in schizofrenie te verduidelijken.

J Nutr Gezondheid het Verouderen. 2002;6(1):69-71.

Homocysteine niveaus in bejaarde Spaanse mensen: invloed van pyridoxine, vitamine B12 en folic zure opnamen.

Ortega RM, Jimenez A, Andres P, Faci M, Lolo JM, Lozano-MC, Bermejo LM, Lopez-Sobaler AM, Requejo AM.

Departamento DE Nutricion, Facultad DE Farmacia, Universidad Complutense deMadrid, Spanje. rortega@farm.ucm.es

ACHTERGROND: Serumhomocysteine de niveaus zijn een risicofactor in hart- en vaatziekte. De kennis op hoe de dieetfactoren deze niveaus zouden kunnen beïnvloeden is daarom van belang. DOELSTELLING: Om serumhomocysteine niveaus in een groep bejaarde mensen te evalueren en het effect te analyseren van pyridoxine, vitamine B12 en folic zure opnamen op deze niveaus. ONTWERP: De studieonderwerpen waren 130 onafhankelijk-leeft bejaarde mensen over de leeftijd van 65. Een dieetstudie werd uitgevoerd gebruikend een voedselverslag van 7 dagen. Serumhomocysteine de niveaus werden bepaald door HPLC. VLOEIT voort: Beteken pyridoxine, waren de vitamine B12 en folate opnamen 67.2+/16.8%, 392.8+/549.2% en 84.5+/28.3% van geadviseerde respectievelijk waarden. Met betrekking tot geslacht, werden de verschillen gezien slechts voor vitamineb12 opname (9.1+/12.7 microg/dag bij mannen, en 6.5+/8.8 microg/dag in vrouwen). Één of andere 93.6% van onderwerpen toonde pyridoxineopnamen onder geadviseerd die, zoals 17.6% met betrekking tot vitamine B12 en 72.8% met betrekking tot folic zuur. Homocysteine niveaus waren 12.4 micromol/l (12.6+/3.7 micromol/l bij mannen en 12.2+/7.9 micromol/l in vrouwen) (P<0.05). Geen significante verschillen werden gezien in homocysteine niveaus tussen onderwerpen met lager dan geadviseerde opnamen van pyridoxine of vitamine B12 en die met betere opnamen. Nochtans, toonden de onderwerpen met folic zure opnamen onder 200 microg/dag hogere homocysteine niveaus (13.0+/6.7 micromol/l) dan onderwerpen met meer adequate opnamen (10.9+/4.1 micromol/l) (P<0.05). CONCLUSIE: Het dieet van de studieonderwerpen, vooral met betrekking tot pyridoxine en folic zuur kunnen zou worden verbeterd. Opheffen van de opname van de laatstgenoemden zou vooral nuttig kunnen zijn in het controleren van homocysteine niveaus en het risico van hart- en vaatziekte.

J Nutr Gezondheid het Verouderen. 2002;6(1):75-7.

Verminderde serumconcentraties van riboflavine en ascorbinezuur, en het pyridoxal-5-fosfaat van de bloedthiamine het pyrofosfaat en in geriatrische patiënten met en zonder drukpijnlijke plekken.

Selvaag E, Bohmer T, Benkestock K.

Afdeling van geneeskunde, het Universitaire Ziekenhuis van Aker, Oslo, Noorwegen.

ACHTERGROND: De patiënten met drukpijnlijke plekken zijn als deel van hun behandeling reefed met energie en proteïnen met variërend resultaat geweest. Het is onzeker, echter geweest, in een welke mate deze patiënten ook van micronutrients werden uitgeput die kritiek zouden kunnen zijn voor zweer het helen. DOELSTELLING: Om de voedingsopname en de voedingsstatus van een aantal micronutrients in geriatrische druk pijnlijke patiënten en in aangepaste controles te bestuderen. ONTWERP: De voedingsopname en de voedingsstatus als antropometrische maatregelen, serumconc. van albumine, werd het zink, en van vitaminen (ascorbinezuur, riboflavine, calcidiol), gemeten. Het het thiaminepyrofosfaat en pyridoxal-5-fosfaat werden bepaald in geheel bloed van 11 geriatrische intern verpleegde patiënten met drukpijnlijke plekken en 11 pasten controles aan. VLOEIT voort: Serumconc. van ascorbinezuur beduidend (p< 0.05) meer werd verminderd in druk pijnlijke patiënten (mean+/-S.D.) 4.2+/3.4 (ug/ml) dan in controlepatiënten 7.4+/5.4 (ug/ml) dat nog lager was dan in een verwijzingsgroep (10.9+/1.9) (ug/ml). In alle geriatrische patiënten in vergelijking met de verwijzingsgroep, conc. van serum-riboflavine werd verminderd tot ongeveer 15%, thiamine-pyrofosfaat en pyridoxine-5-fosfaat in geheel bloed en serumcalcidiol aan ongeveer 50%, zonder enige verschillen tussen de druk pijnlijke patiënten en de aangepaste controles. CONCLUSIE: Refeeding van druk pijnlijke patiënten die vaak zijn katabool en behoeften aan proteïne en energie verhoogd zou, micronutrients moeten omvatten niet alleen om geadviseerde dieettoelagen te behandelen, maar voldoende om normale voedingsstatus voor individuele micronutrient te bereiken.

Stomatologiia (Mosk). 2002;81(2):45-9.

[Complexe diagnose van aangeboren schedeldysostosis in kinderen]

[Artikel in Rus]

Iakubov RK, Azimov MI.

Tien patiënten (van 3-15 jaar) werden met aangeboren schedeldysostosis onderzocht door een pediater, een geneticus, een gastroenteroloog, een neuropathologist, een oftalmoloog, een endocrinoloog, en een orthopedist. Naast de klinische tekens kenmerkend van erfelijke veelvoudige ontwikkelingstekorten, openbaarde de studie veranderingen in de kaken en temporomandibular gezamenlijke en lokale factoren bevorderend de vooruitgang van misvormingen van de kaken. De duidelijke en inapparent pathologische veranderingen en de dysfuncties in gastro-intestinale organen werden vergeleken door dysfuncties van de centrale en autonome zenuwstelsels, risico van maxillofacial en algemene misvormingen, en tekens van aangeboren wanorde in calcium, melkzuur, en pyridoxinemetabolisme. De resultaten vergen analyses van het bloed en de urine en ontwikkeling van nieuwe methodes voor de diagnose van aangeboren schedeldysostosis en verbetering van methodes voor de correctie van deze voorwaarde.

Turk J Pediatr. 2002 januari-breng in de war; 44(1): 54-7.

Scherpe isoniazid neurotoxiciteit in kinderjaren.

Citak A, Kaya O, Ucsel R, Karabocuoglu M, Uzel N.

Afdeling van Pediatrische Noodsituatie, het Universitaire Instituut van Istanboel van Kindgezondheid, Turkije.

De scherpe isoniazid (INH) vergiftiging is ongewoon in kinderen. Hoewel de meeste artsen van INH-hepatotoxicity zich bewust zijn, worden de scherpe INH-vergiftiging en zijn behandeling niet goed erkend. INH wordt meer en meer gebruikt om de verspreiding van tuberculose te controleren, en de artsen zouden zijn potentieel fatale gevolgen moeten kennen. INH-de overdosis is gekend om in snel begin van beslagleggingen, metabolische zuurvergiftiging en verlengde obtundation te resulteren. Wij melden twee secundaire gevallen van obtundation aan INH-overdosis die onmiddellijk door pyridoxine werd omgekeerd. Het parenterale pyridoxinebeleid is een efficiënte methode in INH-intoxicatie. Het intraveneuze formulier van pyridoxine moet in de eenheden van de noodsituatiezorg beschikbaar zijn, en INH-de giftigheid zou in om het even welke patiënt met vuurvaste beslagleggingen en metabolische zuurvergiftiging moeten worden verdacht.

Arterioscler Thromb Vasc Biol. 2001 Dec; 21(12): 2072-9. De homocysteine-verminderende behandeling op lange termijn met folic zuur plus pyridoxine wordt geassocieerd met verminderde bloeddruk maar niet met betere armslagader endothelium-dependent vaatverwijding of de slagaderstijfheid van de halsslagader: een proef van 2 jaar, willekeurig verdeelde, placebo-gecontroleerde.

Ra van Van Dijk, Rauwerda JA, Steyn M, Twisk JW, Stehouwer-CD.

Instituut voor Cardiovasculair Onderzoek Vrije Universiteit, Afdeling van Interne Geneeskunde, het Universitaire Ziekenhuis Vrije Universiteit, Nederland.

Homocysteine wordt geassocieerd met atherothrombotic ziekte, die door verenigingen van homocysteine niveaus met bloeddruk, endothelial functie, of slagaderlijke stijfheid kan worden bemiddeld. In placebo-gecontroleerd, verdeelde klinische proef willekeurig, maten wij bloeddruk, armslagader endothelium-dependent vaatverwijding, en gemeenschappelijke slagaderstijfheid van de halsslagader in 158 klinisch gezonde siblings van patiënten met voorbarige atherothrombotic ziekte bij basislijn en na 1 en 2 jaar van homocysteine-verminderende behandeling met folic zuur (5 mg) plus pyridoxine (250 mg). Bedoeling-aan-traktatie analyses tot deelnemers worden beperkt (n=130) die minstens 1 meting ondergingen nadat het basislijnbezoek dat vergeleken met placebo toonde, behandeling met folic zuur plus pyridoxine werd geassocieerd met 3.7 mm systolisch van Hg (95% ci -6.8 tot -0.6 mm van Hg) lagere en een 1.9 lagere diastolische bloeddruk mm van Hg (95% ci -3.7 tot -0.02 mm van Hg) tijdens de proeftijd die van 2 jaar. Samen met het verminderde voorkomen van de abnormale eerder gemelde tests van de oefeningselektrocardiografie, steunen onze resultaten de hypothese dat homocysteine-verminderende behandeling met folic zuur plus pyridoxine gunstige vasculaire gevolgen heeft. Omdat geen gevolgen zouden kunnen worden aangetoond bij de armslagader endothelium-dependent vaatverwijding of voor gemeenschappelijke slagaderstijfheid van de halsslagader, steunt de huidige studie niet de hypothese dat de cardiovasculaire gevolgen van homocysteine door deze factoren, op zijn minst in klinisch gezonde individuen worden bemiddeld.

J erft Metab Dis. 2001 Dec; 24(8): 833-42. Effect van nieuwe die veranderingen in het methylenetetrahydrofolatereductase gen op biochemische fenotypes wordt beoordeeld: een familiestudie.

Tonetti C, Amiel J, Munnich A, Zittoun J.

De dienst d'Hematologie Biologique, Hopital Henri Mondor, Creteil, Frankrijk.

Methylenetetrahydrofolatereductase (MTHFR) de deficiëntie werd geïdentificeerd in twee van de vier kinderen geboren van nonconsanguineous ouders. Één van de beïnvloede kinderen stelde sommige klinische bevindingen tentoon die de deficiëntie van cystathionine bèta-synthase voorstellen; MTHFR-activiteit werd uiterst verminderd. Bovendien werden hyperhomocysteinaemia, hypomethioninaemia, lage totale folate, vooral methylfolate in rode bloedcellen, en verminderde methylfolate/totale folate verhouding gevonden. Twee die veranderingen, op exon 1 van het gen die nog niet arginine veranderen worden gemeld om codon tegen te houden en één andere op exon 9 die arginine veranderen in tryptofaan werden in beide die kinderen in de samenstellings heterozygous staat geïdentificeerd met een gemeenschappelijk polymorfisme, 1298A>C, ook in de heterozygous staat wordt geassocieerd. De moeder, homozygous voor de verandering op exon 9 en voor het polymorfisme 1298A>C op exon 7, was klinisch en biochemisch normaal, met normale folate status, hoofdzakelijk methylfolate niveaus in rode bloedcellen, hoewel MTHFR-de activiteit matig was verminderd. De vader, heterozygous voor overgangsarginine om codon tegen te houden en voor het gemeenschappelijke polymorfisme 677C>T op exon 4, stelde belangrijke biochemische abnormaliteiten, hyperhomocysteinaemia en lage methylfolateniveaus in rode bloedcellen tentoon, maar was klinisch normaal. De onaangetaste kinderen hadden een biochemisch patroon dicht bij dat van hun moeder en waren heterozygous voor de verandering op exon 9 en ook voor het twee gemeenschappelijke polymorfisme, 677C>T en 1298A>C. In de beïnvloede kinderen, werden sommige biochemische abnormaliteiten, met inbegrip van folate status, vooral methylfolate niveaus, met behandeling verbeterd die methyltetrahydrofolic zuur, hydroxocobalamin, pyridoxine en betaine combineren; nochtans, homocysteine bleven de concentraties hoog en methionine de concentraties werden verminderd. De vader werd behandeld met folic zuur, dat gedeeltelijk biochemische abnormaliteiten verbeterde. Het effect van deze veranderingen wordt besproken.

J Nutr. 2001 Dec; 131(12): 3208-11. Biologische beschikbaarheid en anti-oxyderende activiteit van sommige voedselsupplementen in mannen en vrouwen die de test D-Roms gebruiken als teller van oxydatieve spanning.

Cornelliu, Terranova R, Luca S, Cornelli M, Alberti A.

Loyola University Medical Center, Stritch-School van Geneeskunde, Maywood, IL 60153, de V.S. corcon@katamail.com

Het meeste anti-oxyderend tonen tegenstrijdig gedrag omdat in het biologische milieu, om onvoorspelbare redenen, zij kunnen worden prooxidants. Onlangs, werd een nieuwe eenvoudige methode om oxydatieve spanning in serum te controleren ontwikkeld. Deze test ontdekt de derivaten van reactieve zuurstofmetabolites (D-Roms). Hydroperoxides worden omgezet in basissen die N, n-diethyl-paragraaf-Phenylendiamine oxyderen en die door spectrofotometrische procedures als U.CARR kunnen worden ontdekt. (Carratelli-eenheden). Één U.CARR beantwoordt aan 0.8 mg/l waterstofperoxyde. In de normale waaier van onderwerpenu.carr waarden van 250 tot 300. De waarden buiten dit gamma wijzen op een wijziging van de prooxidant/anti-oxyderende verhouding. Op basis van deze methode, testten wij drie verschillende formules van anti-oxyderend (F1, F2, F3) in 14 blijkbaar gezonde vrijwilligers (11 mannen en 3 vrouwen). Formule 1 werd samengesteld uit 5 mg zink, 48 microgselenium, 400 microgvitamine a (als retinol acetaat), 50 microgbeta-carotene, 15 mg-vitamine E (als dl-alpha--tocopherylacetaat) en 10 mg l-Cysteine. Formule 2 werd samengesteld uit 30 mg-bioflavonoids van citrusvrucht, 30 mg vitamine C (als l-Ascorbinezuur), 10 mg-coenzyme Q (10) en 1 mg-vitamine B-6 (als pyridoxinewaterstofchloride). Formule 3 werd samengesteld uit Formule 1 plus Formule 2. Elke formule werd voorbereid in droge capsules (formulering D1, D2, D3) of in een vloeibare vorm (formulering P1, P2, P3). Elke formulering werd beheerd 1 week in een oversteekplaatsontwerp. Een 15% afwijking van U.CARR-niveaus werd gekozen als afgesneden waarde voor een significante verandering in oxydatieve spanning. De formules F1 en F3 verminderden gemiddelde U.CARR-niveaus in de meeste behandelde onderwerpen (t-test, P < 0.05), terwijl F2 niet actief was. Vloeibare formuleringen waren actiever dan droge formuleringen (chi (2) test, P < 0.05). In sommige gevallen, werd een lichte verhoging van oxydatieve spanning ontdekt. Deze minimale verhogingen werden niet betrekking gehad op enige bepaalde anti-oxyderende formule. Bij één onderwerp slechts, het beleid van de droge formulering (D1), verhoogde oxydatieve spanning op een niveau dat de afgesneden waarde bereikte. Samenvattend, wanneer het anti-oxyderend in combinatie bij lage dosering worden genomen verminderen zij oxydatieve spanning, en weinig relevante prooxidant activiteit is opspoorbaar

J Paediatr Kindgezondheid. 2001 Dec; 37(6): 592-6. Pyridoxine-afhankelijke beslagleggingen: een gevalrapport en een kritiek overzicht van de literatuur.

Gupta VK, Mishra D, Mathur I, Singh KK.

Afdeling bij pasgeborenen, Ministerie van Pediatrie, Dr. Ram Manohar Lohia Hospital, New Delhi, India.

De pyridoxine-afhankelijke beslagleggingen zijn erkend, hoewel zeldzaam, oorzaak van hardnekkige beslagleggingen in pasgeborenen. De patiënten met deze autosomal recessieve wanorde hebben terugkomende beslagleggingen die zijn bestand tegen conventionele middelen tegen stuipen maar dramatisch aan intraveneus beleid van pyridoxine antwoorden. Life-long aanvulling met pyridoxine wordt vereist om beslagleggingsherhaling te verhinderen. Bij gebrek aan een biologische teller voor de ziekte, wordt de klinische diagnose vaak vertraagd en de strenge neurologische nawerking is gemeenschappelijk. Hierin, rapporteren wij over de klinische cursus van een pasgeborene met pyridoxine-afhankelijke beslagleggingen. De vertraagde normalisatie van het elektroencefalogram en een normaal ontwikkelingsresultaat (bij 15 maanden van leeftijd) op een dosis 10 mg/kg pyridoxine zijn distinctieve eigenschappen van het onderhavige geval. Wij herzien ook recente klinische observaties en neurochemical studies die voor zover we weten van deze wanorde hebben toegevoegd.

N Engeland J Med. 2001 29 Nov.; 345(22): 1593-600.

Commentaar in: • N Engeland J Med. 2002 4 April; 346(14): 1093-5. • N Engeland J Med. 2002 4 April; 346(14): 1093-5. Verminderd tarief van coronaire restenosis na het verminderen van plasmahomocysteine niveaus.

Schnyder G, Roffi M, Speld R, Flammer Y, Lange H, Eberli Fr, Meier B, Turi ZG, Hess OM.

Afdeling van Cardiologie, Zwitsers Cardiovasculair Centrum Bern, het Universitaire Ziekenhuis. g.schnyder@lycos.com

ACHTERGROND: Wij hebben eerder een vereniging tussen opgeheven totale plasmahomocysteine niveaus en restenosis na percutane coronaire angioplasty aangetoond. Wij ontwierpen deze studie om het effect te evalueren van het verminderen van plasmahomocysteine niveaus op restenosis na coronaire angioplasty. METHODES: Een combinatie van folic zuur (1 mg), vitamine B12 (microg 400), en pyridoxine (10 mg)--bedoeld als folate behandeling--of de placebo werd beheerd aan 205 patiënten (beteken [de leeftijd van +/-BR], 61+/11 jaar) zes maanden na succesvolle coronaire angioplasty in prospectief, dubbelblind, willekeurig verdeelde proef. Het primaire eindpunt was restenosis binnen zes maanden zoals die door kwantitatieve coronaire angiografie wordt beoordeeld. Het secundaire eindpunt was een samenstelling van belangrijke ongunstige hartgebeurtenissen. VLOEIT voort: De basis-tand kenmerken en de aanvankelijke angiografische resultaten na coronaire angioplasty waren gelijkaardig in de twee studiegroepen. Folate behandeling verminderde plasmahomocysteine beduidend niveaus van 11.1+/4.3 tot 7.2+/2.4 micromol per liter (P<0.001). Bij follow-up die, was de minimale luminal diameter beduidend groter in de groep aan folate behandeling wordt toegewezen (1.72+/0.76 versus 1.45+/0.88 mm, P=0.02), en de graad van vernauwing was minder streng (39.9+/20.3 versus 48.2+/28.3 percenten, P=0.01). Het tarief van restenosis was beduidend lager in patiënten aan folate behandeling (19.6 versus 37.6 percenten, P=0.01) worden toegewezen, zoals de behoefte aan revascularization van het doelletsel was (10.8 versus 22.3 percenten, P=0.047 die). CONCLUSIES: De behandeling met een combinatie van folic zuur, vitamine B12, en pyridoxine vermindert homocysteine beduidend niveaus en vermindert het tarief van restenosis en de behoefte aan revascularization van het doelletsel na coronaire angioplasty. Deze goedkope behandeling, die minimale bijwerkingen heeft, zou als adjunctive therapie voor patiënten moeten worden beschouwd die coronaire angioplasty ondergaan.

Orv Hetil. 2001 11 Nov.; 142(45): 2459-67.

[De pathogenese van diabetes en leverneuropathies]

[Artikel in Hongaar]

Winkler G, Kempler P.

Fovarosi Szent Janos Korhaz, II. Belgyogyaszati Osztaly.

Pathomechanism van neuropathies verbonden aan diabetes en de chronische leverziekten zijn slecht begrepen. Zowel zijn de metabolische als vasculaire factoren betrokken bij de pathogenese van diabetesneuropathie. Het schijnt waarschijnlijk, dat microangiopathy enerzijds en de veranderingen van diverse metabolische wegen toe te schrijven aan hyperglycemie anderzijds meer verwant zijn aan elkaar dan het eerder werd voorgesteld. Het salpeteroxyde kan het verband tussen de metabolische en vasculaire hypothesen van diabetesneuropathie zijn. Zowel leiden de verminderde stroom van het endoneurinalbloed als de verhoogde oxydatieve spanning tot verminderde salpeteroxydesynthetase activiteit. Er zijn wijdverspreide interrelaties tussen de meest relevante metabolische veranderingen inbegrepen polyol weghyperactiviteit, de verminderde myoinosit concentratie, de geavanceerde vorming van glycationeindproducten, de verhoogde oxydatieve spanning en de lipideperoxidatie. Veranderingen van hemorheological voorwaarden en primaire hemostasis Leeds in hyperviscosity enkel in verband met verhoogde activiteit van het coagulatiesysteem. Onder patiënten met chronische alcoholische leverziekten is het directe toxische effect van alcohol van bijzonder belang, echter, malabsorptie, stoornis van axoplasmatic vervoer, zijn de veranderingen van meer intermedier metabolisme evenals thiamine en pyridoxinedeficiëntie ook van belang. De rol van verminderde insulinegevoeligheid en diverse graden van glucoseonverdraagzaamheid met betrekking tot chronische leverziekten worden nog onderschat. Het stoornis van proteoglycan metabolisme evenals de verhoogde oxydatieve spanning worden verondersteld om belangrijke factoren in de pathogenese van zowel diabetes als leverneuropathies te zijn. De glucoseauto-oxidatie en de verbeterde lipideperoxidatie dragen ook bij tot verhoogde oxydatieve spanning in patiënten met diabetes en chronische leverziekten. De vitaminee deficiëntie, autoimmun processen, het doorgeven immune complexen, cryoglobulinemia, enkel als veranderingen van vasculaire ontvankelijkheid verbonden aan salpeteroxydeactiviteit speelt een rol in de ontwikkeling van neurale schade van leveroorsprong. Zeer waarschijnlijk, zo ook tot diabetes dragen mellitus, vasculaire veranderingen tot de ontwikkeling van neuropathie in patiënten met chronische leverziekten bij.

Int. J Mol Med. 2001 Nov.; 8(5): 505-8.

Pyridoxal 5 ' - het fosfaat en pyridoxal remmen angiogenese in serum-free analyse van de ratten aortaring.

Matsubara K, Mori M, Matsuura Y, Kato N.

Afdeling van Voedingswetenschap, Faculteit van Gezondheid en Welzijnswetenschap, Prefectural Universiteit van Okayama, 111 Kuboki, Soja, Okayama 719-1197, Japan. kmatsuba@fhw.oka-pu.ac.jp

De Supraphysiologicaldosissen vitamine B6 is gemeld om de tumorgroei en metastase in knaagdieren te onderdrukken. Om te onderzoeken als zijn effect tegen kanker aan afschaffing in angiogenese toe te schrijven is, werd deze studie uitgevoerd om het antiangiogenic effect van pyridoxal 5 ' te onderzoeken - fosfaat (PLP), pyridoxine, pyridoxal en pyridoxamine in een ex vivo serum-free model gebruikende de ratten aortaring van de matrijscultuur. Werden de ratten aortaringen uitgebroed met PLP of pyridoxine (25 micromol/l aan 5 mmol/l). De hogere concentraties van PLP (2.5 en 5 mmol/l) en pyridoxine (5 mmol/l) veroorzaakten volledige remming van microvesseluitloper. Nochtans, toonde de toevoeging van pyridoxine bij 2.5 mmol/l geen volledige remming van angiogenese. PLP remde microvessel bijna helemaal uitloper bij een concentratie van 500 micromol/l en toonde antiangiogenic effect op een dose-dependent manier binnen de waaier van 25-500 micromol/l. Bij 250 micromol/l, was pyridoxal zo efficiënt zoals PLP, maar pyridoxamine was inactief, implicerend dat de aldehydegroep op het antiangiogenic effect betrekking heeft. Deze resultaten wezen op het antiangiogenic effect van PLP en pyridoxal, en stelden voor dat het antitumor effect van hoge niveaus van vitamine B6 door afschaffing van angiogenese zou kunnen worden bemiddeld.

J het Dieet van Gezoemnutr. 2001 Oct; 14(5): 365-70. Riboflavinedeficiëntie in blaasbindweefselvermeerdering: drie gevalrapporten.

McCabe H.

De Voeding van Newcastle, Koninklijke Victoria Infirmary, Newcastle op het Vertrouwen van Tyne Hospitals NHS, Newcastle op de Tyne NE1 4LP, het UK. nutrition@trvi.nuth.northy.nhs.uk

Drie gevallen van klinische riboflavinedeficiëntie worden in kinderen die van 2-10 jaar gemeld een regionale Blaasbindweefselvermeerderingskliniek bijwonen. Riboflavinedeficiëntie als hoekige stomatitis in alle drie patiënten wordt voorgesteld die. De patiënten werden bevestigd om ontoereikende riboflavine te zijn door de activiteit van erytrocietglutathione reductase te analyseren. De patiënten waren niet op routinesupplementen van in water oplosbare vitaminen vóór presentatie en werden behandeld met riboflavinesupplementen als deel van een in water oplosbare complexe vitamine. Bij presentatie, had één patiënt slechte voedingsstatus, maar twee patiënten werden voldoende gevoed, ontvangend nachtelijk Gastrostomy-voer. De gegevens over deze twee patiënten wijzen op een adequate dieetopname van riboflavine, die een mechanisme voor verhoogde vereisten, ontoereikend absorptie of gebruik voorstellen. De extra deficiënties van thiamine, pyridoxine en ijzer werden ook waargenomen. Dit die document meldt het voorkomen van een vitaminedeficiëntie niet eerder in de blaasbindweefselvermeerderingsbevolking wordt gemeld.

Am J Psychiatrie. 2001 Sep; 158(9): 1511-4. Vitamine B (6) in de behandeling van tardive dyskinesia: dubbelblind, placebo-gecontroleerd, oversteekplaatsstudie.

Lerner V, Miodownik C, Kaptsan A, Cohen H, Matar M, Loewenthal-U, Kotler M.

Afdeling van Psychiatrie, het Geestelijke Gezondheidscentrum van Ministerie van volksgezondheidbe'er Sheva, Faculteit van de Universiteit van ben-Gurion van Gezondheidswetenschappen van Negev, Israël. lernervld@yahoo.com

DOELSTELLING: Het doel van de auteurs was een dubbelblinde proef van vitamine B (6) in de behandeling van tardive dyskinesia in patiënten met schizofrenie te leiden. METHODE: Vijftien intern verpleegde patiënten met schizofrenie die onderzoek aan kenmerkende criteria voor tardive dyskinesia voldeed werden willekeurig toegewezen aan behandeling met of vitamine B (6) of placebo 4 weken in een dubbelblind oversteekplaatsparadigma. De Extrapyramidal Schaal van de Symptoomclassificatie werd gebruikt om patiënten wekelijks te beoordelen. VLOEIT voort: Beteken scores op het parkinsonisme en dyskinetic bewegingssubscales van de Extrapyramidal Schaal van de Symptoomclassificatie waren beduidend beter in de derde week van behandeling met vitamine B (6) dan tijdens de placeboperiode. CONCLUSIES: De vitamine B (6) schijnt efficiënt te zijn in het verminderen van symptomen van tardive dyskinesia.

Atherosclerose. 2001 Sep; 158(1): 161-4. De vitamineaanvulling kan de homocysteine verhoging duidelijk verminderen door fenofibrate wordt veroorzaakt die.

Dierkes J, Westphal S, Kunstmann S, Banditt P, Lossner A, Luley C.

Instituut van Klinische Chemie en Biochemie, Leipziger-Streptokok. 44, D-39120 Maagdenburg, Duitsland. jutta.dierkes@medizin.uni-magdeburg.de

De opgeheven homocysteine concentraties zijn een risicofactor voor atherosclerotic ziekte. Onlangs rapporteerde men dat de vermindering van lipiden met fibrates homocysteine met maximaal 40% verhoogt. Aangezien de opgeheven homocysteine concentraties gemakkelijk door vitamineaanvulling kunnen worden verminderd, werd een willekeurig verdeelde, dubbelblinde oversteekplaatsstudie uitgevoerd om het effect van fenofibrate plus folic zuur, vitamine B6 en B12 tegenover fenofibrate plus placebo bij hyperlipidemic mensen te onderzoeken. De oversteekplaatsstudie bestond uit een run-in periode van 6 weken, uit een eerste behandelingsfase van 6 weken, uit een wegspoelingsfase van 8 weken en uit een tweede behandelingsfase van 6 weken. De vitaminen werden gegeven bij dosissen 650 microg folic zuur, 50 microgvitamine B12 en 5 mg-vitamine B6 per dag voor een periode van 6 weken. Na fenofibrate plus placebo was de verhoging van homocysteine concentratie 44+/47%. Na fenofibrate plus vitaminen was het 13+/25%, zijnd beduidend lager dan zonder vitaminen. De verhoging van homocysteine in antwoord op fenofibrate kan het cardioprotective effect van vermindering van lipiden tegengaan. De toevoeging van vitaminen betrokken die bij homocysteine metabolisme kan het grootste deel van de homocysteine verhoging verhinderen na fenofibrate plus placebo wordt gezien. De toevoeging van deze vitaminen aan fenofibrate kan daarom voor routinegebruik worden gerechtvaardigd.

Deskundige Opin Pharmacother. 2001 Sep; 2(9): 1449-60. Homocysteine-verminderende behandeling: een overzicht.

van Guldener C, Stehouwer-CD.

Afdeling van Interne Geneeskunde, het Universitair Ziekenhuis en Instituut van Cardiovasculair Onderzoek, Vrije Universiteit, Amsterdam, Nederland.

De opgeheven het vasten plasmaconcentraties van homocysteine hebben een hoog overwicht bij onderwerpen met hart- en vaatziekte en met een verhoogd risico van atherothrombosis in de meesten, maar niet allen, prospectieve studies ook geassocieerd. De frequentste oorzaken van hyperhomocysteinaemia zijn genetische tekorten, zoals cystathionine-bèta-synthase (CBS) deficiëntie, deficiënties van folic zuur en/of vitamine B12, niermislukking en interferentie in homocysteine metabolisme door drugs of metabolische wijzigingen. In de meeste gevallen, kan geen onderliggende oorzaak worden vastgesteld. De onderwerpen met CBS-deficiëntie worden indien nodig behandeld met pyridoxine met extra folic zuur en betaine. Folic zuur en vitamineb12 deficiënties zouden door aanvulling moeten worden verbeterd. De verhogingen van folate opname door dieetveranderingen of vestingwerk kunnen plasmahomocysteine bij vitamine-volle onderwerpen met normale plasmahomocysteine niveaus ook verminderen. In niermislukking, in de meeste gevallen verbetert folic zure behandeling (1-5 mg/dag) het plasmahomocysteine niveau maar hyperhomocysteinaemia duurt in de meerderheid van patiënten voort. Primaire (vastende) hyperhomocysteinaemia kan met folic zuur (0.5-5 mg/dag) worden behandeld. Identificeert een abnormale methionine-ladende test extra patiënten op risico en postmethionine-ladende hyperhomocysteinaemia zou met een combinatie van pyridoxine en folic zuur moeten worden behandeld. Bij gebrek aan dosis-effect studies, wordt een combinatie van pyridoxine (50 mg) en folic zuur (5 mg) geadviseerd. De grote klinische proeven zijn momenteel aan de gang om de rol te vestigen van homocysteine-verminderende therapie in de secundaire preventie van atherothrombotic ziekte. Gezien het efficiënte, goedkope en veilige karakter van therapie met folic zuur en pyridoxine, kan een beleid aan het scherm worden goedgekeurd en zeer riskante patiënten behandelen tot deze proeven zijn besloten.

Hart Lung Transplant. 2001 Sep; 20(9): 964-9. Het pyridoxine verbetert endothelial functie in harttransplantatieontvangers.

Mijnwerkersse, Cole DE, Evrovski J, Forrest Q, Hutchison S, Holmes K, Ross HJ.

Afdeling van Geneeskunde, Universiteit van Toronto, Toronto, Ontario, Canada.

ACHTERGROND: Endothelial dysfunctie is gemeenschappelijk in harttransplantatieontvangers en voorspelt de ontwikkeling van de ziekte van de transplantatie kransslagader. Hyperhomocysteinemia wordt geassocieerd met endothelial dysfunctie in de algemene bevolking, is gemeenschappelijk in transplantatieontvangers, en met de ziekte van de transplantatie kransslagader geassocieerd. Aldus zou de therapie die homocysteine concentraties vermindert endothelial functie ook kunnen verbeteren en het risico van de ziekte van de transplantatie kransslagader verminderen. Folate en het pyridoxine zijn belangrijke cofactoren in verschillende aspecten van homocysteine metabolisme. Het doel van deze studie was te bepalen of folate of pyridoxine de aanvulling endothelial functie in harttransplantatieontvangers verbetert. METHODES EN RESULTATEN: Dit was een dubbelblinde, willekeurig verdeelde, placebo-gecontroleerde proef. Wij wezen 31 transplantatieontvangers aan of pyridoxine (n = 11:100 mg/dag), folate (n = 12:5 mg/dag), of placebo (n = 8) toe 10 weken. Het vasten en post-methionine-ladings (methionine 100 mg/kg mondeling) homocysteine de concentraties werden bepaald. De armslagader stroom-bemiddelde dilatatie werd gebruikt als maatregel van endothelial functie. Bij follow-up, namen nota wij van geen significante veranderingen in homocysteine concentraties in om het even welke groepen. Nochtans, werd de pyridoxineaanvulling geassocieerd met een significante verbetering van endothelial functie (2.8 +/- 6.7 tot 6.9 +/- 6.3, p = 0.05). Geen significante die veranderingen werden in patiënten gezien met folate of placebo worden behandeld. CONCLUSIES: Het pyridoxine, maar de niet folate aanvulling, verbeteren beduidend endothelial functie in harttransplantatieontvangers.

Vestn Oftalmol. 2001 sep-Oct; 117(5): 37-40.

[Voorspellende betekenis van lokale en systemische indicatoren van lipideperoxidatie en anti-oxyderend systeem in het perforeren van wonden van de ogen en hun tijdcursus tijdens lokale anti-oxyderende behandeling]

[Artikel in Rus]

Arkhipovalt., Dolgova IG.

Werden het de parameters malonic dialdehyde van de lipideperoxidatie (MDA) en de dienic stamverwanten (gelijkstroom) en superoxide anti-oxyderende van defensie (AOD) waarden dismutase (ZODE), katalase, alpha--tocoferol gemeten in bloedneutrophils en de traanvloeistof van 66 patiënten op dagen 1-2, 7-8, 14-15, en 21-22 na het perforeren van wond van eerst, tweede, derde, en vierde graad van strengheid volgens P, 1. Lebekhov en in herhaalde verwonding, en de tijdcursus van deze parameters tijdens lokale behandeling met therapeutische films met emoxipin werden en emoxipin + piridoxine geëvalueerd. Een stabiele verhoging van de niveaus van MDA en gelijkstroom-van bloedneutrophils, de daling van katalase, de ZODE, en de alpha--tocoferolniveaus in bloedneutrophils, en de daling van katalaseenzymen en de ZODEactiviteiten in de traanvloeistof van verwond oog die van dagen 7-8 beginnen zijn prognostically ongunstige tekens. Deze gegevens veroorzaken het gebruik van lokale en systemische behandeling met anti-oxyderend (emoxipin, tocoferol, enz.) in het perforeren van wonden die van de eerste dagen na de verwonding beginnen. Het goede klinische en anti-oxyderende effect werd waargenomen na behandeling met oculaire therapeutische films met emoxipin en piridoxine.

Ann Plast Surg. 2001 Augustus; 47(2): 153-60. Experimenteel model van pyridoxine (B6) deficiëntie-veroorzaakte neuropathie.

Dellonal, Dellon S, Tassler PL, Ellefson RD, Hendrickson M.

Afdeling van Plastische chirurgie en Neurochirurgie, de Universitaire School van Johns Hopkins van Geneeskunde, Baltimore, M.D., de V.S.

Een pyridoxine (B6) dieetdeficiëntie werd bestudeerd in vrouwelijke volwassen Sprague Dawley ratten door de analyse van het achterste-lidmaat lopen-spoor. De serumniveaus van pyridoxine en drie metabolites werden gekwantificeerd door hoge druk vloeibare chromatografie met fluorescentiemeting. Morphometric analyse van de heup- en latere tibial zenuwen (van binnen de tarsal tunnel) werd uitgevoerd na 1 jaar op een dieet ontoereikend in vitamine B6. De b6-Ontoereikende ratten ontwikkelden abnormale lopen-spoorpatronen tegen 8 maanden, en deze spoorparameters waren verschillend van leeftijd en geslacht-aangepaste van de normale voedingcontrole ratten bij p < 0.05 niveau. Het toevoegen van B6 bij 10 delen per miljoen aan het dieet toen verbeterde gedeeltelijk deze parameters, terwijl de toevoeging van 30 delen per miljoen B6 het abnormale patroon volledig verbeterde. Serumpyridoxal de concentratie correleerde met de functionele parameters die, die van een gemiddelde van 115 mg per liter aan 39.5 mg per liter (p < 0.05) dalen, en met het B6 additief verbeteren. Morphometric analyse toonde dat de b6-Ontoereikende zenuw van de tarsal tunnel een verminderde dichtheid van de zenuwvezel (p < 0.001) had, met een normaal totaal aan myelinated het aantal van de zenuwvezel, en een verhoogde axon-aan-myelinverhouding (p < 0.003). Men besluit dat een dieet totaal ontoereikend in vitamine B6 in een randneuropathie resulteert.

Eur J Clin investeert. 2001 Augustus; 31(8): 667-71. Homocysteine niveaus in patiënten met lipideapheresis die worden behandeld: effect van een vitaminetherapie.

Julius-U, Pietzsch J, Gromeier S, Schorr H, Herrmann W.

Het bont Klinische Stoffwechselforschung, Universitatsklinikum Dresden, Dresden, Duitsland van Institut und Poliklinik. julius@rcs.urz.tu-dresden.de

ACHTERGROND: De patiënten met lipideapheresis reeds worden behandeld lijden aan familiehypercholesterolemia en strenge coronaire hartkwaal die: om het even welke extra risicofactor is gevaarlijk voor deze patiënten. Hyperhomocysteinemia is gezien als een onafhankelijke risicofactor voor atherosclerotic ziekte. Wij controleerden de frequentie van hyperhomocysteinemia in de patiënten van lipideapheresis en maten het effect van een vitaminetherapie. MATERIALEN EN METHODES: Zestien heterozygous patiënten (10 mannetjes, 6 wijfjes) werden bestudeerd, die door drie verschillende apheresisprocedures werden behandeld. Homocysteine werd gemeten gebruikend immunoassay van de enzymomzetting. Cystathionine en het methylmalonic zuur werden beoordeeld door gaschromatografie/massaspectrometrie. De serumniveaus van folic zuur, vitamine B12, en vitamine B6 werden ook bepaald. De patiënten ontvingen een vitaminetherapie (3 mg folate, 60 microgcyanocobalamine, 10 van het pyridoxinemg waterstofchloride dagelijks) 12 weken. VLOEIT voort: In 9 van de 16 patiënten, plasmahomocysteine werden de niveaus gevonden om worden opgeheven (> 12 micromol L (- 1)). De Cystathionineconcentraties werden ook verhoogd, vooral in die patiënten met opgeheven homocysteine. Waren de Methylmalonic zure niveaus niet opgeheven. Waren het serum folic zuur, de vitamine B6, en de vitamineb12 concentraties aanvankelijk in de normale waaier en gecorreleerd niet met plasmahomocysteine. De vitaminetherapie verminderde de plasmahomocysteine concentraties beduidend in alle patiënten door 33%. Onder die patiënten met opgeheven homocysteine niveaus, werd de optimale waaier < 12 micromol L (- 1) voor homocysteine zelden bereikt. CONCLUSIES: In patiënten met lipideapheresis worden behandeld, kan een hyperhomocysteinemia die vaak worden gezien. De constellatie zowel opgeheven homocysteine als cystathionineniveaus richt aan het bestaan van deficiënties van de weefselvitamine, folate en vitamine B-6, die door vitaminesupplementen werden verbeterd. Omdat het methylmalonic zuur meestal normaal was, werd een vitamine B-12 deficiëntie niet bewezen.

J Nutr. 2001 Augustus; 131(8): 2204-7. Onderdrukken de vitamine B-6-Aangevulde die diëten met een lage vitamine B-6 dieet worden vergeleken azoxymethane-veroorzaakte dubbelpunttumorigenesis in muizen door celproliferatie te verminderen.

Si van KOMATSU, Watanabe H, Oka T, Tsuge H, Nii H, Kato N.

Faculteit van Toegepaste Biochemie, de Universiteit van Hiroshima, higashi-Hiroshima 739-8528, Japan.

De mannelijke ICR-muizen werden onderzocht voor het effect van vitamine B-6 [pyridoxine (PN) HCl] op azoxymethane-veroorzaakte dubbelpunttumorigenesis. De muizen werden de diëten gevoed die 1, 7, 14 of 35 mg PN HCl/kg bevatten 22 weken, en werden gegeven een wekelijkse injectie van azoxymethane (5 mg/kg-lichaam) voor aanvankelijke 10 weken. Vergeleken met het dieet van 1 mg PN HCl/kg, onderdrukten de diëten van 7, 14 en 35 mg PN HCl/kg beduidend de de weerslag en het aantal dubbelpunttumors, proliferatie van de dubbelpuntcel en uitdrukkingen van proteïnen c -c-myc en c -c-fos. Voor sommige variabelen, waren de diëten van 14 en 35 mg PN HCl/kg efficiënter dan het 7 mg/kg-dieet. Supplementaire vitamine B-6 had geen invloed op het aantal dubbelpunt apoptotic cellen. De resultaten stellen voor dat opheffende dieetvitamine B-6 dubbelpunttumorigenesis door celproliferatie te verminderen onderdrukt.

Eur J Clin Nutr. 2001 Juli; 55(7): 605-9. Een bevolkingsstudie van de invloed van bierconsumptie op folate en homocysteine concentraties.

Mayer O Jr, Simon J, Rosolova H.

Centrum van Preventieve Geneeskunde, 2de Ministerie van Interne Geneeskunde, Medische Faculteit Charles University, Pilsen, Tsjechische Republiek. mayerjr@lfp.cuni.cz

DOELSTELLING: Milde hyperhomocysteinemia is een significante en onafhankelijke risicofactor voor vaatziekten. Bloed wordt de totale homocysteine concentratie (tHcy) beschouwd als om het product van een interactie tussen genetische en voedingsfactoren in het bijzonder opname van folate, vitamine B12 en pyridoxine. Het doel van de studie was te bepalen of de regelmatige opname die van bier hoop folate en andere vitaminen bevatten de concentraties van het tHcybloed beïnvloedt. ONTWERP: Onderzoek op basis van de bevolking in dwarsdoorsnede. Het PLAATSEN: Volwassen bevolking, ingezetenen van Pilsen (Tsjechische Republiek) en nabijheid. ONDERWERPEN: De bevolkingsreeks omvatte 292 mannetjes en 251 wijfjes op de leeftijd van 35-65 y, bedoelen leeftijd 53.4 y. Alle onderwerpen werden onderzocht door een standaardprotocol voor klinische, antropometrische en laboratoriumschattingen. HOOFDresultatenmaatregelen: tHcy werd gemeten door hoge druk vloeibare chromatografie met fluorescente opsporing, bloedfolate en B12 niveaus immunochemically gebruikend commerciële uitrustingen. VLOEIT voort: De bieropname werd geassocieerd met van de bloedfolate en vitamine B12 concentraties positief en met tHcyconcentratie negatief. Door categorieën van bieropname, hadden de onderwerpen met opname van 1 l of dagelijks meer beduidend lagere tHcy en hogere folate concentraties dan die die lagere dagelijkse bieropname melden. CONCLUSIE: De gematigde bierconsumptie kan helpen om de tHcyniveaus in de normale waaier te handhaven toe te schrijven aan hoge folate inhoud. Folate van bier kan zo tot het beschermende effect bijdragen van alcoholgebruik op hart- en vaatziekte in bevolking met over het algemeen lage folate opname van andere voedingsmiddelen. SPONSORING: Gesteund door toelage 301/00/P089 Grant Agency van Tsjechische Republiek en Intern Grant Agency van het Ministerie van volksgezondheid.

Pediatr Gastroenterol Nutr. 2001 Juli; 33(1): 64-9. Thiamine, riboflavine, pyridoxine, en vitamine Cstatus in te vroeg geboren babys die parenterale en darm- voeding ontvangen.

Friel JK, Bessie JC, Belkhode SL, Edgecombe C, steele-Rodway M, Downton G, Kwa-PG, Aziz K.

Afdeling van Biochemie, Herdenkingsuniversiteit van Newfoundland, St. John, Newfoundland A1B 3X9, Canada. jfriel@morgan.ucs.mun.ca

ACHTERGROND: Er is een gebrek van gegevens over in water oplosbare vitaminestatus in lage geboortegewichtzuigelingen. Daarom de doelstelling van de auteurs was huidige het voeden protocollen te beoordelen. METHODES: De auteurs maten serumconcentraties voor riboflavine, pyridoxine, en vitamine C en functionele analyses voor thiamine en riboflavine in de lengte in 16 te vroeg geboren babys (geboortegewicht, 1.336 +/- 351 g; gestational leeftijd, 30 +/- 2.5 weken) alvorens voeding (tijddagen 1, 2 +/- 1), tijdens supplementaire of parenterale voeding (tijd 2, 16 +/- 10 dagen) te ontvangen en terwijl het ontvangen van volledige mondelinge voeding (tijd 3, 32 +/- 15 dagen). In plasma, werd de vitamine C colorimetrisch gemeten, en de riboflavine en het pyridoxine werden gemeten gebruikend krachtige vloeibare chromatografie. De test van erytrociettransketolase als functionele evaluatie van thiamine en de erytrocietglutathione reductase test voor riboflavine werden colorimetrisch gemeten. VLOEIT voort: In tijd 1, was de voedende opname van vitaminen te verwaarlozen omdat de zuigelingen intraveneuze glucose en slechts elektrolyten ontvingen. De opnamen verschilden tussen tijd 2 en tijd 3 voor thiamine (microg 510 +/- 280 en 254 +/- 115. kg-1. D-1, respectievelijk), riboflavine (microg 624 +/- 305 en 371 +/- 193. kg-1. D-1, respectievelijk), en pyridoxine (394 +/- 243 en 173 +/- 85 kcal microg/100, respectievelijk), maar niet voor vitamine C (32 +/- 17 en 28 +/- 12 mg. kg-1. D-1, respectievelijk). Bloedniveaus af en toe 1, 2, en 3 waren voor thiamine (4.9 +/- 2.7%, 3.3 +/- 6.6%, en 4.1 +/- 9% de test van erytrociettransketolase, respectievelijk), riboflavine (0.91 +/- 0.31, 0.7 +/- 0.3, 0.91 +/- 0.18 erytrocietglutathione reductase test, respectievelijk), riboflavine (19.5 +/- 17, 23.3 +/- 8.6, 17.6 +/- 10 ng/mL, respectievelijk), pyridoxine (32 +/- 25, 40 +/- 16, 37 +/- 26 ng/mL, respectievelijk), en vitamine C (5.2 +/- 3, 5 +/- 2.2, 10 +/- 5 microg/mL, respectievelijk) en verschilden niet in die tijden. CONCLUSIES: De huidige opnamen van deze vitaminen, behalve misschien vitamine C, tijdens parenterale en darm- voeding schijnen om in adequate plasmaconcentraties en normale functionele indexen te resulteren.

Eur J Pharmacol. 2001 Jun 15; 421(3): 157-64. B de vitaminen veroorzaken een antinociceptive effect in de azijnzuur en formaldehydemodellen van nociception in muizen.

Franca DS, Souza-AL, Almeida Kr, Dolabella SS, Martinelli C, Coelho-MM.

Laboratorium van Farmacologie, Faculteit van Apotheek, Federale Universiteit van Minas Gerais, Avenida Olegario Maciel 2360, 30180-112 MG, Belo Horizonte, Brazilië.

Het effect van sommige B-vitaminen in chemische en thermische modellen van nociception in muizen werd onderzocht. De het verenigingsthiamine/pyridoxine/cyanocobalamin (TPC, 20-200 mg/kg, i.p. of per os), veroorzaakten de thiamine, het pyridoxine (50-200 mg/kg, i.p.) of de riboflavine (3-100 mg/kg, i.p) een antinociceptive die effect, niet door naloxone (10 mg/kg, i.p.) wordt veranderd, in het azijnzuur die model kronkelen. De behandeling 7 dagen met thiamine/pyridoxine/cyanocobalamin (100 of 200 mg/kg, i.p.), thiamine (50 of 100 mg/kg) of pyridoxine (50 of 100 mg/kg) of scherpe behandeling met riboflavine (6 of 12 die mg/kg, i.p) remde de nociceptive reactie door formaldehyde wordt veroorzaakt. De B-vitaminen remden niet de nociceptive reactie in het warmhoudplaatmodel. Zowel de thiamine verminderden van 7 dagen/het pyridoxine/cyanocobalamin (100 mg/kg, i.p.) of de scherpe riboflavine (25 of 50 mg/kg, i.p.) behandeling gedeeltelijk formaldehyde-veroorzaakt hindpaw oedeem. Het B-vitaminen antinociceptive effect kan remming van de synthese impliceren en/of werd de actie van ontstekingsbemiddelaars aangezien het niet in het warmhoudplaatmodel werd waargenomen, niet omgekeerd door naloxone, slechts was de tweede fase van de formaldehyde-veroorzaakte nociceptive reactie geremd, en het formaldehyde-veroorzaakte hindpaw oedeem werd verminderd.

Dev Med Child Neurol. 2001 Jun; 43(6): 413-5.

Pyridoxine-afhankelijke beslagleggingen die aan uiterst - laag antwoorden - dosispyridoxine.

Grillo E, DA Silva RJ, Jr. van Barbato JH.

Het ziekenhuis Infantil Joana de Gusmio, Servico DE Neurologia, Florianopolis-Sc, Brazilië. egrillo@matrix.com.br

Wij rapporteren over een mannelijke die zuigeling met pyridoxinegebiedsdeel en beslagleggingen van geboorte, met farmacologische dosissen pyridoxine bij 4 maanden van leeftijd wordt gecontroleerd. De beslagleggingen hielden tussen 30 en 80 dagen van leeftijd op toen de eigenlijk-lage dosissen pyridoxine in een multivitaminsupplement werden gegeven. De dagelijkse dosis was 0.5 mg die aan 0.08 tot 0.16 mg/kg/dag beantwoordden wanneer de gewichtsaanwinst wordt overwogen. In vorige verslagen de dosissen zich van 0.2 tot 30 mg/kg/dag hebben uitgestrekt. Een andere distinctieve eigenschap was dat deze zuigeling in een coma ging en hypotonie en onregelmatige ademhaling ontwikkelde toen het pyridoxine door darm- buis werd gegeven die gewoonlijk is gemeld wanneer de vitamine intraveneus wordt gegeven. Het gebruik van lage dosissen pyridoxine in multivitaminsupplementen een verwarrende factor voor vroege diagnose en aangewezen behandeling van pyridoxine-afhankelijke beslagleggingen kunnen zou zijn.

J Nutr. 2001 Jun; 131(6): 1777-86.

Erratum in: • J Nutr 2001 Augustus; 131(8): 2224. De beoordeling van vitamine B-6 status in jonge vrouwen die een gecontroleerd dieet verbruiken die vier niveaus van vitamine B-6 bevatten verstrekt een geschat gemiddeld vereiste en een geadviseerde dieettoelage.

Hansen cm, Shultz TD, Kwak HK, Memon HS, Leklem JE.

Ministerie van Voedselwetenschap en Menselijke Voeding, Washington State University, Pullman, WA 99164-6376, de V.S.

De geadviseerde Dieettoelage (RDA) werd van vitamine B-6 voor jonge vrouwen onlangs van 1.6 tot 1.3 die mg/d verminderd op een adequate plasmapyridoxal fosfaat (PLP) wordt gebaseerd concentratie van 20 nmol/L. Om vitamine B-6 te beoordelen verbruikten de vereisten en aanbevelingen voor opname voor te stellen, zeven gezonde jonge vrouwen een gecontroleerd dieet die 1.2 g verstrekken van protein/kg het lichaamsgewicht voor een 7 D aanpassingsperiode (1.0 mg-vitamine B-6/d) en drie opeenvolgende 14 experimentele periodes van D (1.5, 2.1 en 2.7 mg/d, respectievelijk). Directe en indirecte vitamine B-6 werd statusindicatoren gemeten in plasma, erytrocieten en urine. De indicatoren correleerden met vitamine B-6 sterkst opname [d.w.z., plasma en erytrociet PLP, urine pyridoxic zuur 4 (4-pa) en totale vitamine B-6] waren achteruitgegaan op vitamine B-6 opname en dieetvitamine B-6 aan eiwitverhouding. Het omgekeerde voorspelling adequaat gebruiken en geschatte vitamine B-6 van basislijnwaarden vereiste. De adequate waarden werden bepaald voor plasma PLP en urine 4-pa van basislijnwaarden van 60 vorige onderwerpen, gebruikend de statistische die methode door Sauberlich wordt voorgesteld. De huidige studie suggereert een vitamine B-6 Geschatte Gemiddelde Eis (OOR) ten aanzien van jonge vrouwen van de proteïne van 1.1 mg/d of 0.016 mg/g-, en een RDA van de proteïne van 1.5 mg/d of 0.020 mg/g-. Wanneer de resultaten van deze studie met gegevens van vier andere recente studies worden gecombineerd, voorspellen de gecombineerde gegevens een OOR van de proteïne van 1.2 mg/d of 0.015 mg/g-, en een RDA van de proteïne van 1.7 mg/d of 0.018 mg/g-. Deze studie suggereert dat huidige vitamine B-6 RDA niet kan adequaat zijn.

J Biol Chem. 2001 4 Mei; 276(18): 15107-16. Epub 2000 29 Dec. Pyridoxal fosfaatdeactivering door pyrroline-5-carboxylic zuur. Verhoogd risico van vitamineb6 deficiëntie en beslagleggingen in hyperprolinemiatype II.

Farrant RD, Leurder V, Molens GA, Mellor JM, Langley GJ.

Fysieke Wetenschappen, de Geneesmiddelen van Glaxo Wellcome Onderzoekscentrum, de Houten Weg van Gunnels, Stevenage, SG1 van Hertfordshire 2NY, het Verenigd Koninkrijk. rdf17079@glaxowellcome.co.uk

Wij identificeerden eerder vitamineb6 deficiëntie in een kind die met beslagleggingen voorstellen de waarvan primaire diagnose geërft type II. van wanordehyperprolinemia was. Dit is een niet erkende vereniging, die niet door dieet of medicijn werd verklaard. Wij stelden een hypothese op dat pyridoxal het fosfaat (vitamineb6 coenzyme) door L-Delta (1) - pyrroline-5-carboxylic zuur, de belangrijkste tussenpersoon werd gedesactiveerd die endogeen in hyperprolinemiatype II. accumuleert. De voorgestelde interactie is nu onderzocht in vitro met de spectroscopie van de hoge resolutie1h nuclear magnetic resonance en massaspectrometrie bij pH van 7.4 en temperatuur van 310 K. Drie nieuwe adducts werden geïdentificeerd. Dit waren het resultaat van een Claisen-condensatie (of Knoevenagel-type van reactie) van geactiveerde koolstof c-4 van de pyrroline ring met de aldehydekoolstof van pyridoxal fosfaat. De structuren van adducts werden bevestigd door een combinatie van hoge prestaties vloeibare chromatografie, nuclear magnetic resonance, en massaspectrometrie. Deze interactie is niet voordien gemeld. Van inleidende opmerkingen, condenseert het pyrroline-5-carboxylic zuur ook met andere aromatische en alifatische aldehyden en ketonen, en dit kan een eerder onverdachte generische toevoegingsreactie zijn. Pyrroline-5-carboxylic wordt het zuur zo gevonden om een unieke endogene vitamineantagonist te zijn. De vitamineb6 deactivering kan tot beslagleggingen in hyperprolinemiatype II bijdragen, die tot dusver onverklaard zijn, maar zij kunnen met vitamineb6 aanvulling te voorkomen zijn op lange termijn.

Harefuah. 2001 Mei; 140(5): 369-73, 456.

[Antidepressieeffect van pyridoxine (vitamine B6) in neuroleptic-behandelde schizofrene patiënten met mede-ziekelijke minder belangrijke depressie--inleidende open-label proef]

[Artikel in Hebreeër]

Shiloh R, Weizman A, Weizer N, dorfman-Etrog P, Munitz H.

Het Geha Psychiatrische Ziekenhuis, het Medische Onderzoekscentrum van Felsenstein, het Medische Centrum van Rabin, Beilinson-Campus, Petah Tikva, Israël.

ACHTERGROND: De minder belangrijke depressie wordt gemeld in 20-60% van schizofrene patiënten tijdens diverse stadia van hun wanorde; schadend de naleving van patiënten, reactie op behandeling en verergerend hun algemene prognose. Diverse antidepressiebehandelingen zijn voorgesteld voor dergelijke gevallen maar is de respons gewoonlijk slecht. Het pyridoxine (Vitamine B6) in essentieel voor het juiste metabolisme van diverse neurotransmitters die voor de pathofysiologie van depressie en/of schizofrenie als relevant worden beschouwd is en het gemeld voordelig in het verbeteren van depressieve symptomen als deel van belangrijke depressie, premenstrueel syndroom of „Chinees restaurantsyndroom“. Wij stelden een hypothese op dat de toevoeging van pyridoxine aan aanhoudend neuroleptic behandeling minder belangrijke depressie in schizofrene patiënten kon verbeteren. METHODE: Negen schizofrene patiënten met mede-ziekelijke minder belangrijke depressie namen aan deze studie deel. Alle deelnemers hadden een stabiele onveranderde klinische staat (veranderingen in Korte Psychiatrische Classificatieschaal (BPRS). De schaal voor de Beoordeling van Positieve Symptomen (SAPPEN), en de Schaal voor de Beoordeling van Negatieve symptomen (ZONDER) noteren < 5%) en allen werden gehandhaafd op onveranderde dosissen anti-psychotic drugs minstens 4 opeenvolgende weken voorafgaand aan initiatie van de studie. Ontvangen deelnemers, open-label, pyridoxine 150 mg/dag naast hun anti-psychotic behandeling 4 opeenvolgende weken. De geestelijke status werd geëvalueerd vóór, tijdens, en begin 4 weken van pyridoxinebeleid gebruikend BPRS, de SAPPEN, ZONDER en ham-D. VLOEIT voort: Twee van de negen patiënten (22%), gekenmerkt door hogere aanvankelijke ham-D en ZONDER scores, en door oude dag en langere duur van ziekte, ervaren duidelijke verbeteringen in depressieve symptomen (23% en 28% daling van scores ham-D) na 4 weken van pyridoxinebeleid. In één van deze twee, ging de verbetering van depressieve symptomen van een parallelle daling van ZONDER Scores vergezeld. CONCLUSIE: Een subgroep van schizofrene patiënten met comorbid minder belangrijke depressie kan van pyridoxinetoevoeging aan hun aanhoudend anti-psychotic behandeling profiteren.

J Cardiovasc Pharmacol. 2001 Mei; 37(5): 630-8. Invloed van endoteel op dose-dependent remming en versterking door isoniazid van isosorbide dinitraatontspanning van rattenaorta.

Vidrio H, Fernandez G.

Afdeling van Farmacologie, School van Geneeskunde, Nationale Autonome Universiteit van Mexico, Mexico-City. vidrio@servidor.unam.mx

De invloed van beleid in vivo van isoniazid op het ontspannend middeleffect van werd isosorbide dinitraat bepaald door ratten met diverse dosissen isoniazid vooraf te behandelen en concentratie-reactie krommen aan isosorbide dinitraat in aortaringen te verkrijgen uit deze dieren. In ringen met endoteel, isoniazid versterkte reacties op isosorbide dinitraat bij dosissen 10, 30, en 100 mg/kg; 3 en 300 mg/kg waren zonder effect. In endoteel-beroofde voorbereidingen, was de versterking aanwezig slechts bij 10 mg/kg; 3 en 300 mg/kg geremde ontspannings. Andere experimenten wezen erop dat isoniazid de versterking door pyridoxine werd verhinderd, met theofylline, werd gereproduceerd en niet met morpholinosydnonimine 3 of papaverine voorkwam. Deze resultaten werden geacht met de hypothese compatibel dat isoniazid transsulfuration van homocysteine remt en zijn accumulatie in vasculaire vlotte spier en endothelial cellen veroorzaakt, waar het als thioltussenpersoon functioneert en tot verbeterde bioactivation van isosorbide dinitraat leidt. De versterking scheen om slechts met gematigde verhogingen van homocysteine voor te komen.

Am J Clin Nutr. 2001 April; 73(4): 759-64. Laag-dosisvitamine B-6 vermindert het vasten plasma effectief homocysteine in gezonde bejaarde personen die en volle riboflavine folate zijn.

McKinleymc, McNulty H, McPartlin J, Spanning JJ, Pentieva K, Afdeling M, Waterkeringsdg, Scott JM.

Het Centrum van Noord-Ierland voor Dieet en Gezondheid, Universiteit van Ulster, Coleraine, het Verenigd Koninkrijk.

ACHTERGROND: De actuele gegevens stellen voor dat physiologic dosissen vitamine B-6 geen significant homocysteine-verminderend effect hebben. Het is mogelijk dat een effect van vitamine B-6 in vorige proeven wegens een veel groter effect van folic zuur, vitamine B-12, of allebei werd gemist. DOELSTELLING: Het doel van deze studie was het effect te onderzoeken van laag-dosisvitamine B-6 aanvulling op het vasten totale homocysteine (tHcy) concentraties in gezonde bejaarde personen die met folate en riboflavine vol werden gemaakt. ONTWERP: Tweeëntwintig gezonde bejaarde personen op de leeftijd van 63-80 y werden aangevuld met een lage dosis vitamine B-6 (1.6 mg/d) 12 weken in een willekeurig verdeelde, dubbelblinde, placebo-gecontroleerde proef na volheid met folic zuur (400 microg/d 6 weken) en riboflavine (1.6 mg/d 18 weken); geen van de onderwerpen had een vitamine B-12 deficiëntie. VLOEIT voort: Folic zure aanvulling verminderde het vasten tHcy door 19.6% (P < 0.001). Na folic zure aanvulling, strekten de concentraties van basislijnthcy zich van 6.22 uit tot 23.52 micromol/L en 10 onderwerpen hadden suboptimale vitamine B-6 status (plasma pyridoxal-p < 20 nmol/L). De bidirectionele analyse van verschil toonde aan dat de significante verbetering in vitamine B-6 status in antwoord op vitamine B-6 aanvulling (op basis van beide pyridoxal-p: en de erytrocietaspartate aminotransferase activeringscoëfficiënt werd) weerspiegeld in een significante vermindering van plasmathcy van 7.5%. CONCLUSIES: Laag-dosisvitamine B-6 vermindert het vasten effectief plasmathcy bij gezonde onderwerpen die zowel folate als volle riboflavine zijn. Dit stelt voor dat om het even welk die programma op de behandeling of de preventie van hyperhomocysteinemia wordt gericht vitamine B-6 zou moeten omvatten aanvulling.

Am J Epidemiol. 2001 1 April; 153(7): 688-94. Vereniging van B-Vitaminen pyridoxal 5 ' - fosfaat (B (6)), B (12), en folate met longkankerrisico bij oudere mensen.

Hartman TJ, Woodson K, stolzenberg-Solomon R, Virtamo J, Selhub J, Barrett MJ, Albanes D.

Afdeling van Voeding, de Universiteit van de Staat van Pennsylvania, Universitair Park, PA, de V.S.

Genestelde werd een geval-controle studie uitgevoerd binnen het alpha--Tocoferol, Beta-Carotene de de Studiecohort van de Kankerpreventie voor verenigingen tussen geselecteerde B-Vitaminen (folate, vitamine B (6) te testen, vitamine B (12)) en inherente longkanker. Deze proef werd geleid in Finland tussen 1985 en 1993. Het serum werd geanalyseerd voor deze voedingsmiddelen en homocysteine onder 300 longkankergevallen en aanpaste controles (1:1). De kansenverhoudingen en 95% de betrouwbaarheidsintervallen werden bepaald in voorwaardelijke en onvoorwaardelijke (controlerend voor de passende factoren) logistische die regressiemodellen, na het aanpassen de index van de lichaamsmassa, jaren van het roken, en aantal sigaretten per dag worden gerookt. Geen significante verenigingen werden gezien tussen serumfolate, vitamine B (12), of homocysteine en longkankerrisico. De auteurs vonden beduidend lager risico van longkanker onder mensen die 6) niveaus de hogere van de serumvitamine B (hadden. Vergeleken met mensen met de laagste vitamineb (6) concentratie, hadden de mensen in vijfde quintile over helft van het risico van longkanker (kansenverhouding = 0.51; 95% betrouwbaarheidsinterval: 0.23, 0.93; p-tendens = 0.02). Het aanpassen om het even welke andere serumfactoren (folate, B (12), en homocysteine) of alleen of niet veranderde gezamenlijk beduidend deze ramingen. Dit is het eerste rapport van een voor de toekomst uitgevoerde studie om een rol voor vitamine B (6) in longkanker voor te stellen.

Eur J Obstet Gynecol Reprod Biol. 2001 April; 95(2): 218-21. De niet-zwangere volumestatus van de bloedsomloop voorspelt vroeger verder zwangerschapsresultaat in normotensive thrombophilic preeclamptic vrouwen.

Spaanderman ME, Aardenburg R, Ekhart-Th, van Eyndhoven HW, van der Heijden OW, van Eyck J, DE Leeuw PW, Peeters LL.

Het academische Ziekenhuis Maastricht en Sophia Hospital Zwolle, P.O. Box 5800, 6202 AZ, Maastricht, Nederland. marc.spaanderman@og.unimaas.nl

ACHTERGROND: Preeclampsia schijnt om op een reeds bestaande hemodynamic, hemostatische, auto-immune of metabolische wanorde worden toegevoegd. Wij testten de hypothese dat bij normotensive thrombophilic vroeger preeclamptic onderwerpen, de niet-zwangere volumestatus van de bloedsomloop de ontwikkeling van verdere zwangerschap met te hoge bloeddruk en/of foetale de groeibeperking voorspelt. METHODES: In 250 niet-diabeticus vroeger preeclamptic vrouwen en 15 normale parous controles, maten wij en berekenden de volgende variabelen minstens 5 maanden postpartum bij dag 5 (+/2) van de menstruele cyclus: beteken slagaderlijke druk, de index van de lichaamsmassa, plasmavolume en de het klonteren functie. In de verdere zwangerschap die wij, geboortegewicht, geboortegewichtcentile en de weerslag van vroegtijdige geboorte, foetale de groeibeperking, zwangerschap-veroorzaakte hypertensie, preeclampsia en HELLP-Syndroom hebben bepaald. Wij omvatten in de definitieve analyse slechts normotensive onderwerpen met een thrombophilic fenotype op het tijdstip van het pre-zwangere onderzoek, dat een verdere singletonzwangerschap had, aan de gang zijnde voorbij 16 weken zwangerschap binnen 1 jaar na pre-zwangere evaluatie. Bijgevolg, waren 23 vroeger preeclamptic vrouwen en 12 controles verkiesbaar voor definitieve analyse. De thrombophilic preeclamptic deelnemers ontvingen vroeger aspirin in combinatie met low-molecular-weight heparine door zwangerschap. Als thrombophilia op basis van hyperhomocysteinemia werd gediagnostiseerd, bestond de behandeling uit aspirin, pyridoxine en folic zuur, in plaats daarvan. VLOEIT voort: Onder 250 had preeclamptic 131/250 (52%) vroeger een normotensive thrombophilic fenotype. Slechts 23 (18%) van deze 131 deelnemers hadden een aan de gang zijnde zwangerschap binnen 1 jaar. Zij werden toegewezen aan subgroep THROMB. Geen van de controles had hypertensie of thrombophilia. In tegenstelling, 12/15 (80%) controles had een aan de gang zijnde zwangerschap binnen een jaar. De observaties in de THROMB-subgroep werden vergeleken met die in de controlegroep. Niets van de demografische basislijn en bloeddrukvariabelen verschilde tussen THROMB en controles. Met betrekking tot zwangerschapsresultaat, werd de weerslag van de volgende zwangerschapscomplicaties waargenomen bij THROMB-onderwerpen: vroegtijdige geboorte: 9%, zwangerschap-veroorzaakte hypertensie: 44%, preeclampsia: 13%, HELLP-Syndroom: 13%, en foetale de groeibeperking: 30%. Een laag niet-zwanger plasmavolume werd gevonden om voor complicaties met te hoge bloeddruk in een verdere zwangerschap ontvankelijk te maken. CONCLUSIE: Het pre-zwangere plasmavolume in normotensive thrombophilic preeclamptic vrouwen heeft vroeger vooruitlopende waarde met betrekking tot complicaties met te hoge bloeddruk in de verdere zwangerschap.

J Adolesc Gezondheid. 2001 April; 28(4): 328-37. Dieetopname als cardiovasculaire risicofactor in Costa Rican-adolescenten.

Monge-Rojas R.

Costa Rican Institute voor Onderzoek en Onderwijs op Voeding en Gezondheid (INCIENSA), Ministerie van volksgezondheid, Tres Rios, Costa Rica.

DOEL: Om Costa Rican-de dieetopname van adolescenten als factor van het hart- en vaatziekte (CVD) risico te evalueren. METHODES: De dieetopname werd bepaald gebruikend de voedselverslagen van 3 dagen; de voedende inhoud van snel die voedsel in schoolcafetaria wordt voorbereid werd berekend door de gewogen verslagen. VLOEIT voort: Rond 30% van adolescenten overschrijden de Amerikaanse dieetaanbeveling van de Hartvereniging voor totaal vet en verzadigd vet. Ongeveer 50% meldde een cholesterolopname hoger dan 100 kcal mg/1000. Gemiddeld, ontmoeten 45% van adolescenten de dieetvezelaanbeveling van 10 kcal g/1000, 66% van de geadviseerde dagelijkse toelage voor vitaminen E en B (6), of geen rond 25% voor folic zuur. Een hoger deel stedelijke adolescenten voldoet niet aan de gevestigde dieetaanbeveling om CVD te verhinderen. CONCLUSIES: Om verdere verhogingen van het Costa Rican-sterftecijfer van CVD te vermijden, is het noodzakelijk om primaire die preventieprogramma's te ontwikkelen, worden georiënteerd om de voedingsgewoonten van de adolescent te wijzigen. De scholen hebben het potentieel om dergelijke programma's uit te voeren, aangezien minstens 60% van alle adolescenten in Costa Rica in middelbare scholen worden ingeschreven.

J Ren Nutr. 2001 April; 11(2): 67-72. Homocysteine die effect van verschillende multivitaminvoorbereidingen verminderen in patiënten met eindstadium nierziekte.

Dierkes J, Domrose-U, Bosselmann KP, Neumann KH, Luley C.

Instituut van Klinische Chemie en Biochemie, Maagdenburg, Duitsland.

DOELSTELLING: Hyperhomocysteinemia komt in bijna 100% van patiënten met eindstadium nierziekte voor (ESRD) en met verhoogde morbiditeit en mortaliteit geassocieerd. Het middel om opgeheven homocysteine concentraties te verminderen is aanvulling met folic zuur, vitamine B6, en vitamine B12. Nochtans, dosissen vitaminen zijn voor geoptimaliseerde behandeling worden de vereist onderworpen van debat dat. Daarom werd het effect van 2 verschillende multivitaminvoorbereidingen op de homocysteine concentraties in patiënten met ESRD vergeleken. ONTWERP: De patiënten ontvingen 3 keer per week of 2 tabletten van voorbereiding A (800 microg folic zuur, 6 microgvitamine B12, 10 mg-vitamine B6), 2 tabletten van voorbereiding B (160 microg folic zuur, geen vitamine B12, 10 mg-vitamine B6), of placebo voor een periode van 12 weken met controle van totale homocysteine (tHcy) niveaus bij basislijn, en bij 4, 8, en 12 weken. Het PLAATSEN: De studie werd uitgevoerd bij het Universitaire die Ziekenhuis van Maagdenburg, Duitsland in patiënten met ESRD met chronische intermitterende onderhoudshemodialyse wordt behandeld. VLOEIT voort: De voorbereiding A verminderde beduidend de tHcyconcentratie door bijna 50%, terwijl de voorbereiding B niet de tHcyconcentratie in vergelijking met placebo veranderde. Nochtans, werd tHcy niet in de meerderheid van patiënten genormaliseerd die voorbereidingsa. CONCLUSIE ontvangen: De vermindering van tHcy bereikte door een multivitamin die 800 die microg folic zuur bevatten was aanzienlijk en nog hoger dan de vermindering in aanvullingsstudies wordt gemeld die hogere dosissen folic alleen zuur gebruiken. Niettemin die, lijkt hyperhomocysteinemia in ESRD-patiënten vrij vuurvast aan vitamineaanvulling, in tegenstelling tot resultaten in gezonde vrijwilligers worden verkregen.

Jpn J Clin Oncol. 2001 April; 31(4): 172-4. Gevalrapport: hand-voet syndroom door mondelinge fluoropyrimidine S1 wordt veroorzaakt dat.

Elasmar SA, Saad ED, Hoff-PM.

Afdeling van Gastro-intestinale Medische Oncologie en Spijsverteringsziekten, de Universiteit van Texas M.D. Anderson Cancer Center, Houston 77030, de V.S.

Het hand-voet syndroom (HFS) is een vrij gemeenschappelijke zijdeeffect van fluorouracil (5-FU) chemotherapie dat ook met mondelinge fluoropyrimidinecapecitabine is geassocieerd. Interessant, is HFS vrijwel onbekend om uit behandeling met UFT voort te vloeien, een combinatie van tegafur en uracil. Tegafur is prodrug van 5-FU en is een component van S1, een andere mondelinge fluoropyrimidine actief in een verscheidenheid van stevige tumors. Wij kennen van slechts één eerder beschreven geval van s-1-Veroorzaakte HFS en het hier gemelde geval is de eerste om volledige documentatie van dit voorkomen te verstrekken. De pathofysiologie van chemotherapie-veroorzaakte HFS blijft onbekend en zeer weinig pathologische informatie is beschikbaar. De behandeling bestaat uit actuele verzachtende therapie, hoewel het pyridoxine nu en dan voordelig is geweest. De studie van HFS kan een belangrijk inzicht verstrekken in de farmacologie van fluoropyrimidines en voor efficiënte preventieve strategieën voor deze bijwerking van chemotherapie toestaan.

Med Sci Sports Exerc. 2001 April; 33(4): 512-8. Effect van energiebeperking en oefening op vitamine B-6 status van vrouwen tijdens lactatie.

Lovelady CA, Williams JP, slaat KE, Moreno KL, Taylor ml, Leklem JE op.

Afdeling van Voeding en Voedingsdienstsystemen, de Universiteit van Noord-Carolina in Greensboro, 27402-6170, de V.S. Cheryl_Lovelady@uncg.edu

DOEL: De lactatie verhoogt vitamine B-6 vereisten omdat zijn concentratie in moedermelk met moederopname verwant is en het is essentieel voor zuigelingen. De oefening kan het vereiste ook verhogen omdat het gebruik en afscheiding van vitamine B-6 verhoogt. Daarom het doel van deze studie was te bepalen of de de energiebeperking en oefening vitamine B-6 status van melk afscheidende vrouwen beïnvloedden. METHODES: De de borst gevende vrouwen met een index van de lichaamsmassa > of = 25 en < of = 30 kg x m (- 2) willekeurig toegewezen bij 4 weken postpartum of energieopname door 500 kcal x D (- 1 werden) en oefening voor 45 min x D (- 1) beperken, 4 D x week (- 1) (de groep van het gewichtsverlies, WG) of om gebruikelijke dieet en niet oefening (controlegroep, CG) 10 weken te handhaven. De vrouwen werden een supplement gegeven die 2.0 mg van vitamine B-6 bevatten. De metingen omvatten vitamine B-6 concentraties in moedermelk en plasma, plasmapyridoxal 5 ' - phosphate, en erytrocietalanine aminotransferase activiteit. VLOEIT voort: WG verloor meer gewicht (- 4.4 +/- 0.4 versus -0.9 +/- 0.5 kg, P < 0.01) dan CG. De cardiovasculaire geschiktheid steeg met 12% in WG, in vergelijking met 3% in CG (P = 0.09). Melkvitamine B-6 concentraties steeg in zowel groepen (161 +/- 107 en 191 +/- 85 nmol x L (- 1), WG en CG, respectievelijk, P = 0.05). Er waren geen significante verschillen in andere vitamine B-6 parameters. Gewicht en lengteaanwinst (2.06 +/- 0.21 en 1.83 +/- 0.17 kg; 8.6 +/- 0.6 en 7.2 +/- 0.5 cm; WG en CG, respectievelijk) van zuigelingen waren niet beduidend verschillend tussen groepen. CONCLUSIES: De de energiebeperking en oefening van 4 tot 14 weken postpartum in te zware, de borst gevende vrouwen die adequate dieetopnamen en 2.0 mg van supplementaire vitamine B-6 verbruiken beïnvloeden ongunstig geen vitamine B-6 status of de zuigelingsgroei.

De vetzuren van prostaglandinesleukot Essent. 2001 april-Mei; 64 (4-5): 265-71. Gevolgen van dieetbeleid op korte termijn van marginale niveaus van vitamine B (6) en vistraan op lipidesamenstelling en anti-oxyderende defensie in rattenweefsels.

Cabrini L, Bergami R, Maranesi M, Carloni A, Marchetti M, Tolomelli B.

Dipartimento Di Biochimica „G. Moruzzi“, via Irnerio 48, Bologna, 40126, Italië.

Vorige verslagen hebben aangetoond dat de vitamineb (6) deficiëntie tot peroxidative spanning in rattenorganen leidt. In dit document, evalueerden wij de gevolgen voor lipideperoxidatie van (zes weken) dieetbeleid op korte termijn van marginale inhoud van vitamine B (6). Een verdere risicofactor van gevoeligheid aan peroxidatie was de aanwezigheid van vistraan met hogere inhoud van meervoudig onverzadigd vetzuur n-3 (LCPUFA). De gelijktijdige vitamineb (6) deficiëntie en de aanwezigheid van vistraan veroorzaakten C18: verhoging 2, C20: daling 4, en vervanging van zowat n-6 LCPUFA met n-3 LCPUFA, zonder veranderingen in de onverzadigde toestandindex. In lever, TBARS-toonde de productie geen verschillen tussen dieetvoorwaarden, terwijl de activiteiten van glutathione-afhankelijke enzymen werden bevorderd. In hart, verhoogde de vistraan lipideperoxidatie, vooral in de vitamine B (6) - ontoereikende groep. Copyright 2001 Harcourt Publishers Ltd.

Am J Clin Nutr. 2001 breng in de war; 73(3): 613-21.

Commentaar in: • Am J Clin Nutr. 2001 breng in de war; 73(3): 499-500. • Am J Clin Nutr. 2001 Oct; 74(4): 558-9. • Am J Clin Nutr. 2002 Mei; 75(5): 948. Determinanten van plasma totale homocysteine concentratie in de Framingham-Nakomelingencohort.

Jacques PF, Bostom AG, Wilson PW, Rijk S, Rosenberg IH, Selhub J.

De Afdeling van Jean de mayer-V.S. van het Onderzoekscentrum van de Landbouw Menselijke Voeding Bij het Verouderen bij Bosjesuniversiteit, Boston, doctorandus in de letteren, de V.S. paul@hnrc.tufts.edu

ACHTERGROND: De gevestigde determinanten van het vasten totale homocysteine (tHcy) concentratie omvatten folate en vitamine B-12 status, de concentratie van de serumcreatinine, en nierfunctie. DOELSTELLING: Onze doelstelling was de relatie tussen bekende en veronderstelde determinanten van het vasten plasmathcy in een cohort op basis van de bevolking te onderzoeken. ONTWERP: Wij onderzochten de relaties tussen het vasten de concentraties van plasmathcy en voedings en andere gezondheidsfactoren in de mannen en de vrouwen van 1960, op de leeftijd van 28-82 y, van de vijfde onderzoekscyclus van de Framingham-Nakomelingenstudie tussen 1991 en 1994, vóór de implementatie van folic zuur vestingwerk. VLOEIT voort: Geometrisch gemiddeldethcy was 11% hoger bij mannen dan in vrouwen en 23% hoger in verouderde personen > of = 65 y dan in personen verouderde < 45 y (P < 0.001). tHcy werd geassocieerd met plasmafolate, vitamine B-12, en pyridoxal fosfaat (P voor tendens < 0.001). Dieetfolate, vitamine B-6, en de riboflavine werden geassocieerd met tHcy onder niet-supplementgebruikers (P voor tendens < 0.01). De tHcyconcentraties van personen die vitamineb supplementen gebruikten waren 18% lager dan die van personen die niet (P < 0.001). tHcy werd positief geassocieerd met alcoholopname (P voor tendens = 0.004), cafeïneopname (P voor tendens < 0.001), serumcreatinine (P voor tendens < 0.001), aantal gerookte sigaretten (P voor tendens < 0.001), en medicijngebruik tegen hoge bloeddruk (P < 0.001). CONCLUSIES: Onze studie bevestigde, in plaatsen het op basis van de bevolking, het belang van de bekende determinanten van het vasten tHcy en suggereerde dat andere dieet en levensstijl, met inbegrip van vitamine B-6, riboflavine, alcohol, en cafeïneopnamen evenals het roken en hypertensie, invloed het doorgeven tHcyconcentraties incalculeert.

J Clin investeert. 2001 breng in de war; 107(6): 675-83.

Commentaar in: • J Clin investeert. 2001 breng in de war; 107(6): 663-4. Hyperhomocysteinemia verbetert vasculaire ontsteking en versnelt atherosclerose in een rattenmodel.

Hofmanndoctorandus in de letteren, Lalla E, Lu Y, Gleason-M., Wolf BM, Tanji N, Ferran LJ Jr, Kohl B, Rao V, Kisiel W, Strenge DM, Schmidt AM.

Universiteit van Artsen en Chirurgen, de Universiteit van Colombia, de Straat van 630 W. 168th, P&S 17-501, New York, NY 10032, de V.S. mah81@columbia.edu

Hoewel hyperhomocysteinemia (HHcy) een bekende risicofactor voor de ontwikkeling van hart- en vaatziekte is, worden de onderliggende moleculaire mechanismen niet volledig nader toegelicht. Hier tonen wij aan dat verbeterde de inductie van HHcy in apoE-ongeldige die muizen door een dieet in methionine wordt verrijkt maar uitgeput in folate en vitaminen B6 en B12 verhoogde atherosclerotic letselgebied en ingewikkeldheid, en uitdrukking van receptor voor geavanceerde glycationeindproducten (WOEDE), vcam-1, weefselfactor, en mmp-9 in vasculature. Deze homocysteine-bemiddelde (HC-Bemiddelde) gevolgen werden beduidend onderdrukt, parallel met verminderde niveaus van plasma HC, op dieetaanvulling met folate en vitaminen B6/B12. Deze bevindingen betrekken HHcy bij atherosclerotic plaquevooruitgang en stabiliteit, en zij stellen voor dat de dieetverrijking in vitaminen essentieel voor het metabolisme van HC beschermende gevolgen in vasculature kan verlenen.

J Hart Lung Transplant. 2001 breng in de war; 20(3): 310-5. Efficiënte behandeling van hyperhomocysteinemia in de ontvangers van de harttransplantatie met en zonder niermislukking.

Kok RC, Parker S, Kingsbury K, Frohlich JJ, Abel JG, Gao M, Ignaszewski-AP.

Universiteit van het Britse Programma van de het Harttransplantatie van Colombia, St. Paul het Ziekenhuis, Vancouver, Brits Colombia, Canada.

ACHTERGROND: De opgeheven totale plasmahomocysteine (tHcy) niveaus zijn geassocieerd met vaatziekte en hogere mortaliteit in patiënten met kransslagaderziekte. Is de ent coronaire ziekte een belangrijke oorzaak van mortaliteit in overlevenden op lange termijn van hartoverplanting, en hyperhomocysteinemia kan één van zijn oorzaken zijn. De doelstellingen van onze studie moesten de doeltreffendheid van een 3 stadium homocysteine-verminderend algoritme in een groep van patiënten 84 van de harttransplantatie (HTx) duidelijk maken en het effect evalueren van nierfunctie op de reactie op homocysteine-verminderende therapie. METHODES: Prospectieve behandeling van 84 Htx-patiënten (mannetje 64; beteken leeftijd, 48 +/- 13 jaar) met tHcy > 75ste percentile bestond uit een algoritme van de 3 stadiumbehandeling: Stadium 1, folic zuur (FA) 2 mg + vitamine (vit) B (mcg 12) 500 dagelijks; Stadium 2, toevoeging van vit B (6) 100 mg dagelijks; Stadium 3, verhoging FA aan 15 mg dagelijks. Serumcreatinine (Cr) en tHcy de niveaus werden gemeten vóór behandeling en 21 +/- 19 weken na elk stadium van behandeling. VLOEIT voort: Alle 3 stadia van behandelings beduidend verminderd gemiddelde tHcy van 22.4 +/- 16.3 (gemiddelde +/- BR) micromol/liter aan 16.3 +/- 6.7 micromol/liter (p < 0.00001), van 17.6 +/- 6.1 micromol/liter aan 15.2 +/- 5.3 micromol/liter (p < 0.0001), en van 16.8 +/- 5.2 micromol/liter aan 15.6 +/- 5.3 micromol/liter (p < 0.05), respectievelijk. De gemiddelde vermindering van basislijn was 38%. De creatinineniveaus veranderden niet beduidend tijdens de studieperiode. De totale plasmahomocysteine niveaus verminderden onder 75ste percentile in 55% van patiënten, met Cr-niveaus beduidend lager in deze groep patiënten (126 +/- 36 micromol/liter versus 182 +/- 65 micromol/liter, p < 0.00001). Nochtans, vonden wij geen significant verband tussen %- verandering in tHcy en basislijncr. CONCLUSIES: In een groep van 84 patiënten van de harttransplantatie met percentile van tHcyniveaus >75th, resulteerden de behandeling met FA en vit B (6) en B (12) volgens een 3 stadiumalgoritme in statistisch aanzienlijke dalingen in gemiddelde tHcyniveaus. Globaal, verminderden de tHcyniveaus 38%, met bereikte de niveaus<75th percentile van doelthcy in 55% van de patiënten. De %- verandering in tHcy werd niet betrekking gehad op Cr. De verdere studies zijn nodig om behandeling van hyperhomocysteinemia te correleren met klinische eindpunten, zoals de tijd aan ontwikkeling van transplantatie vasculopathy en op lange termijn overleving, en de meest aangewezen doelstellingen voor therapie te bepalen.

Nefrologia. 2001 in de war brengen-April; 21(2): 167-73.

[Effect van folic zure aanvulling op totale homocysteine niveaus in hemodialysepatiënten]

[Artikel in het Spaans]

Armada E, Perez Melon C, Otero A, Gayoso P, Rodriguez M, Esteban Morcillo J.

Servicio DE Nefrologia C. Hospitalario Cristal Pinor Ramon Puga 32004 Ourense, Espana.

Hyperhomocysteinemia is een onafhankelijke risicofactor voor cardiovasculaire mortaliteit in ESRD, maar ongeveer 80% van totale homocysteine (tHcy) is verbindend aan albumine (alb). Wij hebben, voor de toekomst, geprobeerd om tHcyniveaus te verminderen door folic zuur (f.a.) en vitamineb6 (P.P.) aanvulling te gebruiken. Alle patiënten op HD die, geen f.a ontvangen. of P.P. en alle nieuwe patiënten, na hun derde maand op HD, werden aangevuld met f.a. 5 mg/48-uren p.o en P.P. 40 mg/week. Wij bepaalden folate, P.P. (RIA), vit. B12, KTV, overblijvende nierfunctie (KRU), PCRn, alb en tHcyniveaus (HPLC). 80 patiënten, verouderen 62.6 +/- 13.6 jaar, tijd op de maanden van HD 16.2 +/- 25.1, allen gedialyseerd met AN69 of PPMA, en het bicarbonaat, was inbegrepen. Het overwicht van hyperhomocysteinemia was 84.4%, en P.P. het tekort was aanwezig in 32%, met folate in de lage normale waaier. Aan het begin van de studie, vóór aanvulling, correleerde tHcy negatief slechts met folate (r = -0.336) (p = 0.01), en niet met P.P., vitamine B12, leeftijd, albumine, KTV, KRU of PCRn. 58 patiënten ontvingen zes maanden van aanvulling, met normalisatie van P.P. niveaus, een aanzienlijke toename van folate (7.25; I.C = 95% betrouwbaarheidsintervallen: 6.45, 8.05 versus 61.29; I.C.: 44.47, 78.11) (p < 0.001), en daling van tHcy (24.1; IC: 21.5, 26.3 versus 19.9; I.C: 17.5, 22.4) (p < 0.05). 33 patiënten hebben 12 maanden van aanvulling, maar ondanks een voortdurende verhoging van folate ontvangen (100.78; I.C: 74.81, 126.74) (p < 0.001), hebben slechts 3 normale niveaus van tHcy; direct correlerend tHcy met albumine (r = 0.56) (p = 0.001), die vergeleken bij het begin van de studie was gestegen (3.39; I.C. 3.29, 3.49 versus 3.50; I.C: 3.37, 3.63) (p < 0.05). CONCLUSIE: Na f.a. en P.P. de aanvulling, hoewel aanvankelijk tHcy wordt verminderd, deze reactie is kortstondig, en tHcy correleert direct met albumineniveaus. De goede voeding verbonden aan HD-geschiktheid, in ontbreken van B-vitaminetekorten, schijnt de beste determinant van tHcyniveaus eerder dan zijn verwijdering door de niveaus van dialysethcy te zijn zou moeten worden geïnterpreteerd rekening houdend met de serumalbumine

Med van onderzoek Exp (Berl). 2001 breng in de war; 200(3): 155-68. Homocyst (e) ine metabolisme in hemodialysepatiënten met vitaminen die B6, B12 en folate wordt behandeld.

Henning BF, Zidek W, Riezler R, Graefe-U, Tepel M.

Severimed Gmbh, Munster, Duitsland.

Hyperhomocyst (e) inemia wordt algemeen goedgekeurd als onafhankelijke atherosclerotic risicofactor. In de meeste hemodialysepatiënten, is het serum homocyst (e) ine duidelijk opgeheven en kan tot voorbarige atherosclerose in deze patiënten bijdragen. Terwijl het gunstige effect van folate aanvulling op serum homocyst (e) ine uitgebreid is bestudeerd, zijn er minder gedetailleerde studies over de gevolgen van cobalamin en pyridoxal alleen fosfaat, of in combinatie met folate. Wij onderzochten het effect van een cursus van vier weken van intraveneuze behandeling met folate (1.1 mg), cobalamin (1.0 mg), en pyridoxal fosfaat (5.0 eens (groep 1), tweemaal (groep 2) of driemaal beheerde mg), (groep 3) weekblad in 33 die hemodialysepatiënten in drie groepen van 11 patiënten wordt verdeeld. Alle patiënten werden gevolgd voor nog eens vier weken nadat de behandeling werd tegengehouden. Het serum homocyst (e) ine, cobalamin, folate en pyridoxal het fosfaat, evenals metabolites van homocyst (e) werden ine, methylmalonate, methylcitrate 2 en cystathionine, bepaald vóór, tijdens en na behandeling. Het basislijnserum homocyst (e) ine correleerde beduidend met serumfolate (P=0.0149), cobalamin (P=0.0047) en pyridoxal fosfaat (P=0.0408). De correlatiesonafhankelijke van andere metabolites of de vitaminen werden gevonden voor methylmalonate (P=0.003) en folate (P=0.029). Al regimes verhoogde serumcobalamin beduidend (in groep 1 van 444 +/- 215 tot 17.303 +/- 11.989 pg/ml, P<0.01; in groep 2 van 542 +/- 633 tot 44.896 +/- 15.772 pg/ml, P<0.001; in groep 3 van 548 +/- 394 tot 77.961 +/- 31.546 pg/ml, P<0.001), maar verhoogde om het even welke andere vitamineniveaus niet. Het serum homocyst (e) werd ine verminderd beduidend door 39.8% +/- 31.9% (P<0.05) met twee en door 30.1% +/- 26.9% (P<0.05) met drie vitaminedosering wekelijks, maar niet met één dosering wekelijks. Aangezien methylmalonate het geweten om een gevoelige teller van cobalamin deficiëntie is te zijn, steunen de gegevens een belangrijke invloed van cobalamin niveaus op basislijn homocyst (e) ine niveaus. De stijgende cobalamin niveaus en de extra behandeling met folate en pyridoxal phosphate 156 kunnen serum verminderen homocyst (e) ine op dezelfde manier als hoge dosissen alleen folate.

Omwenteling Invest Clin. 2001 in de war brengen-April; 53(2): 141-51.

Erratum in: • Juli-Augustus van omwenteling Invest Clin 2001; 53(4): 378.

[Homocysteine metabolisme en risico van hart- en vaatziekten: belang van de voedingsstatus op folic zuur, vitaminen B6 en B12]

[Artikel in het Spaans]

Aleman G, Tovar AR, Torres N.

Depto. Fisiologia DE La Nutricion, Instituto Nacional DE Ciencias Medicas y Nutricion Salvador Zubiran, Mexico, D.F.

Homocysteine is een thiol-bevattend aminozuur uit methionine metabolisme wordt afgeleid dat door twee enzymatische wegen kan worden gedegradeerd die: remethylation en trans-sulfuration. In remethylation, regenereert homocysteine methionine. In de trans-sulfurationweg, homocysteine vormencysteine. wegens het snelle metabolische gebruik, is de plasmaconcentratie van dit aminozuur laag. Homocysteine geeft door als vrij thiol, homocystine, of verbindend aan vrije cysteine of aan cysteine residu's van proteïnen. De genetische tekorten van sommige enzymen in het homocysteine metabolisme, of de voedingsdeficiënties van folic zuur, vitamine B6 en B12 leiden tot een verhoging van homocysteine plasmaconcentratie en aan een toename in hart- en vaatziekten geassocieerd. Op basis van klinische en epidemiologische studies, homocysteine wordt de plasmaconcentratie beschouwd als om een onafhankelijke risicofactor voor de ontwikkeling van atherothrombotic en hart- en vaatziekten. Het huidige overzicht beschrijft het homocysteine metabolisme, het epidemiologische bewijsmateriaal die de vereniging tussen homocysteine en de weerslag van hart- en vaatziekten tonen. De mechanismen waardoor homocysteine vasculaire schade veroorzaakt zijn vermeld. Tot slot worden sommige aanbevelingen gegeven voor de voedingstherapie van patiënten met hyperhomocysteinemia.

Omloop. 2001 20 Februari; 103(7): 1006-11. De aanvulling van atherogenic dieet met B-vitaminen verhindert atherosclerose of geen vasculaire dysfunctie bij apen.

Lentzsr, Piegors DJ, Malinow-M., Heistad DD.

Het Medische Centrum van veteranenzaken, Afdelingen van Interne Geneeskunde, Universiteit van de Universiteit van Iowa van Geneeskunde, de Stad van Iowa, de V.S. steven-lentz@uiowa.edu

ACHTERGROND: Hyperhomocysteinemia wordt geassocieerd met verhoogd risico van atherosclerotic en thrombotic vaatziekte. In vele patiënten, kan hyperhomocysteinemia door dieetaanvulling met B-vitaminen worden behandeld of worden verhinderd, maar het klinische voordeel van B-vitaminen voor de preventie van vaatziekte is niet bewezen. METHODES EN RESULTATEN: Gebruikend een atherogenic dieet dat zowel hyperhomocysteinemia als hypercholesterolemia veroorzaakt, testten wij de hypothese die dieetaanvulling met B-vitaminen (folic zuur, vitamine B (12), en vitamine B (6)) hyperhomocysteinemia, vasculaire dysfunctie, en atherosclerotic letsels bij apen zou verhinderen. Na 17 maanden, voedde het plasma totale die homocysteine van 3.6+/0.3 tot 11.8+/1.7 micromol/L bij apen wordt verhoogd voedde een unsupplemented atherogenic dieet (P<0.01) maar bij apen steeg niet een atherogenic die dieet met B-vitaminen wordt aangevuld (3.8+/0.3 micromol/L). De serumcholesterol steeg van 122+/7 tot 550+/59 mg/dL in de unsupplemented groep (P<0.001) en van 118+/5 tot 492+/55 mg/dL in de aangevulde groep (P<0.001). De reacties op endothelium-dependent vasodilators, zowel in weerstandsschepen in vivo als in de slagader van de halsslagader ex vivo, werden geschaad in een gelijkaardige mate in groepen die deden en vitamine geen supplementen ontvingen. De antistollingsmiddelreacties op de infusie van trombase werden ook geschaad in een gelijkaardige mate in beide groepen. De vitamineaanvulling slaagde er niet in om het intimal dik maken in de slagaders van de halsslagader te verhinderen of iliac. CONCLUSIES: Deze bevindingen tonen aan dat de aanvulling met B-vitaminen verhindert hyperhomocysteinemia maar niet volstaat om de ontwikkeling van vasculaire dysfunctie of atherosclerotic letsels bij apen met duidelijke hypercholesterolemia, zelfs bij gebrek aan reeds bestaande atherosclerose te verhinderen.

Am J Clin Nutr. 2001 Februari; 73(2): 232-9.

Commentaar in: • Am J Clin Nutr. 2001 Oct; 74(4): 558-9. Genetische, dieet, en andere levensstijldeterminanten van plasmahomocysteine concentraties in Chinese mannen en vrouwen op middelbare leeftijd en oudere in Singapore.

Zaag SM, Yuans JM, NGO-CN, Arakawa K, Lee HP, Coetzee GA, Yu-MC.

Afdeling van Communautaire, Beroeps, en Familiegeneeskunde, Nationale Universiteit van Singapore.

ACHTERGROND: De epidemiologische studies hebben de plasmahomocysteine concentratie als risicofactor voor atherothrombotic vaatziekte geïdentificeerd. Er is weinig informatie over de distributies en de determinanten van homocysteine concentraties in Aziatische bevolking. DOELSTELLING: De huidige studie werd ontworpen om de relaties tussen genetische en levensstijlfactoren en plasmahomocysteine concentraties onder Chinees in Singapore te onderzoeken. ONTWERP: Plasma totale werden homocysteine, folate, vitamine B-12, en vitamine B-6 concentraties en genetische variatie bij de methylenetetrahydrofolatereductase (MTHFR) plaats gemeten in 486 Chinese mannen en vrouwen op de leeftijd van 45-74 y in Singapore. De gegevens over dieet en andere levensstijlfactoren werden verzameld in de gesprekken van aangezicht tot aangezicht. VLOEIT voort: De mannen hadden hogere plasmaconcentraties van totale homocysteine dan vrouwen (P = 0.0001). De leeftijd werd positief geassocieerd met plasmahomocysteine bij beide geslachten (P voor tendens = 0.0001). De plasmaconcentraties van folate, vitamine B-12, en vitamine B-6 werden omgekeerd geassocieerd met homocysteine concentraties. Onder individuen met lage plasmafolate, hadden bezitten die die 2 exemplaren van MTHFR-mutantalleles beduidend hogere homocysteine concentraties dan die met > of = 1 exemplaar van wild-typeallele. Het roken van sigaretten, de dagelijkse koffieconsumptie, en de fysieke inactiviteit werden positief betrekking gehad op plasmahomocysteine concentraties bij beide geslachten (P < 0.05). Nochtans, verdwenen deze verenigingen na aanpassing voor plasma folate concentraties. CONCLUSIES: Leeftijd, geslachts, plasmafolate, vitamine B-12 en B-6 de concentraties, en MTHFR-genotype zijn onafhankelijke determinanten van plasmahomocysteine in Chinees op middelbare leeftijd en oudere in Singapore. Deze gecombineerde factoren konden maximaal 40% van de totale variatie in homocysteine concentraties in deze Aziatische bevolking vertegenwoordigen.

Vrije Radic-Med van Biol. 2001 1 Februari; 30(3): 232-7. Het pyridoxine en pyridoxamine verbieden superoxide basissen en verhinderen lipideperoxidatie, eiwitglycosylation, en (Na+ + K+) - ATPase activiteitenvermindering van hoog glucose-behandelde menselijke erytrocieten.

Jain SK, Lim G.

Afdeling van Pediatrie, van de de Universiteitsgezondheid van de Staat van Louisiane de Wetenschappencentrum, 1501 Koningenweg, Shreveport, La 71130, de V.S. sjain@lsuhsc.edu

De vitamineb (6) (pyridoxine) aanvulling is gevonden in het verhinderen van diabetesneuropathie en retinopathy, en glycosylation van proteïnen voordelig. De zuurstofbasissen en de oxydatieve schade zijn betrokken bij de cellulaire dysfunctie en de complicaties van diabetes. Deze studie werd ondernomen om de hypothese te testen dat het pyridoxine (p) en pyridoxamine (PM) superoxide verbieden de radicale productie, lipideperoxidatie en glycosylation, vermindert en (Na+ + K+) - ATPase activiteit in hoog glucose-blootgestelde rode bloedcellen verhoogt (RBC). Superoxide werd de radicale productie beoordeeld door de vermindering van cytochrome C door glucose in de aanwezigheid en het ontbreken van P of PM in een bufferoplossing zonder cellen. Om cellulaire gevolgen te onderzoeken, werd gewassen normaal menselijk RBC behandeld met controle en hoge glucoseconcentraties met en zonder P of PM. Zowel verminderden P als PM beduidend lipideperoxidatie en glycated hemoglobine (HbA (1)) vorming in hoog glucose-blootgesteld RBC. P en PM verhinderden beduidend de vermindering van (Na+ + K+) - ATPase activiteit in hoog glucose-behandeld RBC. Aldus, kan P of PM zuurstof radicale productie remmen, die op zijn beurt de lipideperoxidatie, eiwitdieglycosylation verhindert, en (Na+ + K+) - ATPase activiteitenvermindering door de hyperglycemie wordt veroorzaakt. Deze studie beschrijft een nieuw biochemisch mechanisme waardoor P of PM de aanvulling de ontwikkeling van complicaties in diabetes vertragen of kan remmen.

J Biopharm Stat. 2001 februari-Mei; 11 (1-2): 65-74.

Het analyseren van tellingen, duur, en herhalingen in klinische proeven.

McIntosh J.

Afdeling van Economie, Concordia-Universiteit, Montreal, PQ, Canada. jamesm@vax2.concordia.ca

In 1985 werd de (Byar en Blackard, Urologie, Volume X, 556-561, 1978) gegevensreeks op blaaskanker beschikbaar aan onderzoekers. Sedertdien hebben een aantal studies van het gebruik gemaakt. Nochtans, heeft geen hiervan volledig alle gegevens gebruikt noch zij een methodologie hebben ontwikkeld waarin het mogelijk is om modellen van het aantal herhalingen en duur te schatten die met elkaar verenigbaar zijn. Het doel van dit onderzoek is te bepalen welke, eventueel, van de twee die drugs in de proef, het pyridoxine en theotepa worden gebruikt, efficiënt en, door voorbeeld waren, procedures illustreren die in de analyse van andere klinische proefgegevensreeksen nuttig zouden kunnen zijn. Eerst, wordt het aantal herhalingen gemodelleerd als telling gebruikend Poisson en negatieve binomiale distributies met covariates. Dan Poisson worden de modellen getest op de duur. Tot slot worden de duur en de tumortellingen per herhaling gepast aan meer algemene autoregressieve Wiebull en verbieden binomiale distributies, respectievelijk. Poisson de modellen voor duur worden verworpen ten gunste van de meer algemene autoregressieve modellen. De gegevens over duur en tumortellingen worden getoond om betrouwbaarder van een gevolgtrekkingsstandpunt te zijn dan de gegevens over het aantal herhalingen. De gegevens over duur en tumortellingen tonen vrij afdoend aan dat beide drugs in het behandelen van blaaskanker, een resultaat efficiënt zijn dat verschilt van wat anderen hebben gevonden.

Metabolisme. 2001 Februari; 50(2): 131-4. Homocysteine, het fibrinogeen, en lipoprotein (a) worden de niveaus gelijktijdig in patiënten met chronische nierdiemislukking verminderd met folic zuur, pyridoxine, en cyanocobalamin wordt behandeld.

Naruszewicz M, Klinke M, Dziewanowski K, Staniewicz A, Bukowska H.

Regionaal Centrum voor Atheroscleroseonderzoek, Pomeranian-Academie van Geneeskunde, en de Dialyseeenheid van het Provinciale Ziekenhuis, Szczecin, Polen.

De ischemische hartkwaal en andere complicaties van atherosclerose zijn de gebruikelijke doodsoorzaak in patiënten met chronische niermislukking. De belangrijke factoren verbonden aan vroeg begin van atherosclerose in deze patiënten zijn hyperhomocysteinemia, hyperfibrinogenemia, en opgeheven niveaus van lipoprotein (a) (Lp (a)). Folic zuur (15 mg/d), het pyridoxine (150 mg/d), en cyanocobalamin (1 mg/wk) werden voor 4 weken in 21 patiënten beheerd die dialyse ontvangen, en een gelijktijdige, statistisch significante vermindering van de concentratie van homocysteine, fibrinogeen, en Lp (a) werd gevonden. Een positieve correlatie tussen het verminderen homocysteine en fibrinogeenniveaus werd ook genoteerd. De parameters bestudeerden genaderde presupplementationwaarden 6 maanden nadat de vitaminen werden beëindigd. De resultaten stellen voor dat de vitamineaanvulling een gunstig effect op risicofactoren van atherosclerose in patiënten met niermislukking heeft en dat de interactie tussen homocysteine, fibrinogeen, en Lp (a) kunnen bestaan.

Ann Nutr Metab. 2001; 45(6): 255-8. Plasmafolate maar niet de vitamine B (12) worden of homocysteine de concentraties verminderd na vitamineb (6) aanvulling op korte termijn.

Bosy-Westphal A, Holzapfel A, Tsjechisch N, Muller MJ.

Institutbont Humanernahrung und Lebensmittelkunde, christelijk-Albrechts-Universitat zu Kiel, Dusternbrooker Weg 17, D-24105 Kiel, Duitsland. abosyw@nutrfoodsc.uni-kiel.de

De nadelige gevolgen van hoge vitamineb (6) opname omvatten randneuropathie. De recente studies die zich op de vermindering van plasmahomocysteine als risicofactor concentreren voor vaatziekte toonden aan dat de vitamine B (6) plasma folate niveaus vermindert. De betekenis van dit het vinden is onduidelijk. Wij analyseerden plasma daarom folate en basishomocysteine niveaus evenals de reactie op een mondelinge methionine ladingstest in 8 gezonde individuen before and after een gecontroleerde aanvulling met mondelinge dosissen 25 mg pyridoxine 10 dagen. Plasmapyridoxal het fosfaat steeg van 40.6 +/- 13.6 tot 426.8 +/- 200.3 nmol/l (p < 0.001), terwijl plasmafolate van 6.3 +/- 1.6 tot 4.6 +/1.5 ng/ml (p < 0.01) verminderde, respectievelijk. De plasmavitamine B (12) en de basishomocysteine niveaus bleven onveranderd (234.0 +/- 27.8 versus 217.1 +/- 50.4 pg/ml en 10.9 +/- 4.8 versus 10.1 +/- 3.6 micromol/l). Er was geen significant effect van vitamineb (6) aanvulling op het gebied onder methionine en homocysteine concentratie tegenover tijdkromme. De significante correlaties werden gevonden tussen pre en post-supplementniveaus van folate evenals PLP-niveaus (r = 0.73, p < 0.05; r = 0.75, p < 0.05). Deze gegevens stellen voor dat een dosis 25 die mg-vitamine B (6) 10 dagen wordt aangevuld vermindert plasmafolate maar geen basis en na de maaltijd homocysteine niveaus beïnvloedde die (1) een normale cellulaire beschikbaarheid van folate of (2) een compensatie van geschade homocysteine remethylation voorstellen door verhoogde transsulfuration. Copyright 2001 S. Karger AG, Bazel

Drugsaf. 2001;24(7):553-65.

Drugbehandeling voor tuberculose tijdens zwangerschap: veiligheidsoverwegingen.

Bothamley G.

Tuberculosedienst de de Oost- van Londen, Homerton-het Ziekenhuis, Engeland. graham.bothamley@homerton-hospital.uk

De onbehandelde tuberculose in zwangerschap vormt een significante bedreiging voor de moeder, het foetus en de familie. De aanhankelijkheid aan behandeling is vooral moeilijk in zwangerschap wegens de algemene vrees voor om het even welke medicijn en op zwangerschap betrekking hebbende misselijkheid. De gecontroleerde behandeling is vooral nuttig in het aanmoedigen van aanhankelijkheid. Alle 4 eerste lijndrugs [isoniazid, rifampicin (rifampin), ethambutol en pyrazinamide] hebben een uitstekend veiligheidsverslag in zwangerschap en niet met menselijke foetale misvormingen geassocieerd. De drug-veroorzaakte hepatitis, vooral met isoniazid, is een significant probleem in het behandelen van tuberculose, niet eigenaardig aan zwangerschap; het dichte toezicht op leverfunctie wordt geadviseerd. De inductie van het leverenzym door rifampicin verandert het metabolisme van andere drugs, b.v. zullen de methadondosissen moeten worden verhoogd. Het streptomycine zou niet in zwangerschap moeten worden gebruikt, zoals misschien 1 in 6 babys problemen met hoorzitting en/of saldo zal hebben. Ciprofloxacin heeft het beste veiligheidsprofiel van tweede lijndrugs in de behandeling van drug-resistant tuberculose. De preventieve behandeling met isoniazid kan veilig tijdens zwangerschap worden ondernomen. Het pyridoxine (vitamine B6) zou aan de drugbehandeling van tuberculose in alle zwangere vrouwen moeten worden toegevoegd die isoniazid nemen. Noch is de tuberculine noch vaccin het van bacillecalmette Guerin (BCG) behandelingen voor tuberculose, maar zij spelen een belangrijke rol in het beheer van de ziekte. Tuberculine testen is veilig, maar BCG-de inenting zou moeten in zwangerschap worden vermeden en in plaats daarvan vroeger in het leven worden gegeven.

Gerontologie. 2001 januari-Februari; 47(1): 30-5. Gevolgen op lange termijn van vitamine B (12), folate, en vitamineb (6) supplementen in bejaarde mensen met 12) concentraties de normale van de serumvitamine B (.

Henning BF, Tepel M, Riezler R, Naurath HJ.

Afdeling van Interne Geneeskunde I, Marienhospital, Universiteit van Bochum, Duitsland.

ACHTERGROND: In de bejaarden, deficiënties van folate, cobalamin (vitamine B (12)) en pyridoxal fosfaat (vitamine B (6)) zijn gemeenschappelijk. Metabolites homocysteine, het methylmalonic zuur, methylcitric zuur 2 en cystathionine zijn gemeld om gevoelige tellers van deze vitaminedeficiënties te zijn. DOELSTELLING: Het (269 dagen) effect op lange termijn van een intramusculair vitaminesupplement die 1 mg-vitamine B (12) bevatten, 1.1 mg folate, en 5 mg-vitamine B (6) op serumconcentraties van homocysteine (tHcy), methylmalonic zuur (MMA), methylcitric zuur 2 (2-MCB), en cystathionine (Cysta) werd bestudeerd bij 49 bejaarde onderwerpen met normale niveaus van vitamine B (12). METHODES: Het vitaminesupplement werd beheerd 8 keer over een 21 dagperiode, metabolite werden de concentraties gemeten tot dag 269 (b.v. 248 dagen na het eind van vitamineaanvulling). VLOEIT voort: Van dag 0 tot 21 die, beduidend stegen de serumniveaus van de 3 vitaminen, na onderbreking van aanvulling de niveaus naar basislijn binnen de follow-upperiode zijn teruggekeerd. De niveaus van MMA, van 2-MCB en van tHcy verminderden beduidend tijdens de behandelingsperiode en bereikten basislijn geen waarden binnen de 248 dagperiode. De Cystaniveaus verschilden niet beduidend van basislijn, of tijdens of na behandeling. CONCLUSIE: De niveaus MMA en 2-MCB wijzen eerder op de beschikbaarheid van vitaminen, vooral cobalamin, dan de daadwerkelijke serumniveaus. Aangezien de deficiënties van folate, cobalamin en pyridoxal fosfaat in de bejaarden hyerhomocysteinemia kunnen veroorzaken en vandaar ongunstige gevolgen voor geestelijke prestaties kunnen hebben, kan de bepaling van niveaus MMA en 2-MCB in bejaarde patiënten met geestesstoornissen een rendabele maatregel zijn om geestelijke prestaties te verbeteren of te handhaven. Copyright 2001 S. Karger AG, Bazel.

J Nephrol. 2001 januari-Februari; 14(1): 36-42. Hyperhomocysteinemia in niertransplantatiepatiënten: een onafhankelijke factor van hart- en vaatziekte.

Bertoni E, Marcucci R, Zanazzi M, Rosati A, Brunelli T, Fedi S, Pepe G, Di Maria L, Colonna FM, Lombardi A, Abbate R, Salvadori M.

Niereenheid, het Universitaire Ziekenhuis van Careggi, Florence, Italië. salvadorim@ao-careggi.toscana.it

Hyperhomocysteinemia (Hcy) is een onafhankelijke factor van hart- en vaatziekte, die de belangrijkste oorzaak van morbiditeit en mortaliteit zowel in de patiënten van uremic als niertransplantatie is. Het doel van de studie was Hcy, plasminogen activator inhibitor (pai-1) en lipoprotein (a) (Lp (a) te bepalen) serumniveaus in 70 patiënten met een goed functionerende niertransplantatie. Wij verifieerden ook of deze niveaus door een multivitamintherapie werden gewijzigd. Het genetische polymorfisme van het methylenetetrahydrofolatereductase (MTHFR) enzym dat een hoofdrol in Hcy-metabolisme speelt werd, ook bestudeerd. Wij de niveaus vonden van Hcy, van pai-1 en van Lp (a) met betrekking tot gezonde controleonderwerpen dat beduidend worden opgeheven. De thermolabile vorm van het MTHFR-enzym werd verbonden met hogere Hcy-niveaus. Na een korte tijd op therapie met B6, verminderden B12 en folic zure vitaminen, Hcy en pai-1 aan normale niveaus. De auteurs besluiten dat de hoge Hcy-niveaus een relevante covariate voor hart- en vaatziekte in transplantatiepatiënten zouden kunnen zijn en zij voorstellen dat de vitamineaanvulling als deel van therapie wordt geadviseerd.

J Pathol. 2001 Januari; 193(1): 125-33. Het abnormale vitamineb6 metabolisme in alkalische phosphatase knockoutmuizen veroorzaakt veelvoudige abnormaliteiten, maar niet de geschade beenmineralisering.

Narisawa S, Wennberg C, Millan JL.

Burnham Institute, het Kankeronderzoekcentrum van La Jolla, La Jolla, CA 92037, de V.S.

De weefsel niet-specifieke alkalische phosphatase (TNAP) knockoutmuis is een model die van kinderhypophosphatasia geschade beenmineralisering, toevallen, apnoea, abnormale apoptosis in de zwezerik, abnormale lumbale zenuwwortels, en postnatale dood tonen. Het beleid van vitamine B6 onderdrukt de toevallen in tnap-/de muizen. Dit document onderzoekt in welke mate de diverse die abnormaliteiten in deze muizen worden gezien aan geschaad gebruik van vitamine B6 toe te schrijven zijn, die twee bijkomende benaderingen gebruiken: beleid van vitamine B6 aan de ongeldige muizen van TNAP en ontbering van vitamine B6 in wild-type en van TNAP heterozygous muizen. Het beleid van exogene pyridoxal HCl vertraagde het begin van epileptische aanvallen en verhoogde de levensduur van tnap-/de muizen. De episoden van apnoea hielden en de verschijning van lumbale betere zenuwwortels op, maar hypomineralization en de accumulatie van osteoid bleven met leeftijd verergeren. De controlemuizen voedden een vitamine b6-Uitgeput dieet ontwikkelde toevallen niet te onderscheiden van die waargenomen in tnap-/muizen, abnormale apoptosis in de zwezerik, en het verdunnen van de zenuwwortels, maar toonden geen bewijsmateriaal van de abnormaliteiten van de beenmineralisering. De uitputting van vitamine B6 beïnvloedde niet de capaciteit van primaire culturen van osteoblasts om beenmineraal in vitro te deponeren. Terwijl het abnormale metabolisme van vitamine B6 veel van de abnormaliteiten in dit muismodel van kinderhypophosphatasia verklaart, is het niet de basis van de abnormale mineralisering die deze ziekte kenmerkt.

Przegllek. 2001;58(4):290-2.

Klinische en institutionele aspecten van tegengiftherapie in Rusland.

Ostapenko YN, Luzhnikov EA, Nechiporenko SP, Petrov.

De het toxicologiesinformatie en het Adviserende Centrum, Ministerie van volksgezondheid van de Russische Federatie, 3 blokkeren 7, Sukharevskaya ploshad, 129090 Moskou, Rusland. rtiac@mednet.ru

Het probleem van tegengiftoepassing voor behandeling van scherpe vergiftiging is verwant met epidemiologie en karakterisering van vergiftigingsgevallen, en mogelijkheden om tegengiffen aan gezondheidszorginstellingen te leveren. Om de situatie in Rusland te onderzoeken hebben wij rapporten door behandelingscentra voor 1997-1999, vergelijking van medische hulpnormen voor vergiftigingsbehandeling in Rusland met de WGO-aanbevelingen te vergiftigen geanalyseerd. Het scherpe vergiftigingspatroon varieert in verschillende gebieden. In het bijzonder, wordt het vergiftigen van patroon in grote steden in Europees Rusland en het Oeralgebergte overheerst door geneesmiddelen (tot 63.1%). Pesticide en insecticide de vergiftigingsgevallen overschrijden 1 tot 2%, metaalsamenstellingen en geen methemoglobin die vergiften vormen (onder 1% in elke groep). De tegengiffen worden in Rusland overeenkomstig de aanbevelingen gebruikt in internationale toxicologische praktijk worden goedgekeurd die. Het meest daadwerkelijk is antagonisten van opiaten en benzodiazepines, physostigmine, atropine, pyridoxine, antagonisten van beta-adrenergic blockers, geactiveerde houtskool. Dergelijke tegengiffen aangezien DMPS (Unithiol), n-Acetylcysteine, methylene blauw, amyl nitriet (of natriumnitriet), complexe formers van EDTA ZICH groeperen zijn ook inbegrepen in de lijst van specifieke agenten. Het belangrijkste probleem is dat sommige belangrijke tegengiffen momenteel niet in Rusland worden geproduceerd. Het ministerie van volksgezondheid van de Russische Federatie neemt inspanningen om productie van eerder gekend wat en ook pas ontwikkelde belangrijke tegengiffen te lanceren.

Vopr Pitan. 2001;70(1):12-4.

[Gevolgen van biologisch actieve supplementen voor de middel tegen oxidatie en vitaminestatus van patiënten met hypertensie en ischemische hartkwaal]

[Artikel in Rus]

Tutel'ian VA, Pogozheva AV, Rumiantseva OI, Akol'zina-SE, Lysikova SL, Kodentsova VM, Mal'tsev GIu.

Biologisch actieve additieven in geïntegreerde therapie van patiënten met hart- en vaatziekten tegen een achtergrondlichaamsovergewicht. De invloed van antiaterosclerotic dieet met het omvatten van sommige biologisch actieve additieven, die vitaminen C bevatten, E, B2, B6, beta-carotene, Zn, Mg, Na, K, Ca, werd ik bestudeerd in de patiënten van 91 met ischemische hartkwaal, hypertensieziekte. Het gebruik van biologisch actieve additieven tijdens 4 weken heeft positieve veranderingen van klinische symptomen van ziekten tegen een achtergrond van het verminderen van serumcholesterol, triglyceride en het stijgen van vitaminen A, E, C, B2, B6 bevorderd.

Wiadlek. 2001;54(1-2):11-8.

[Evaluatie van vitamine B6 en calciumpantothenate doeltreffendheid op de haargroei van klinische en trichographic aspecten voor behandeling van diffuse alopecia in vrouwen]

[Artikel in Pools]

Brzezinska-Wcislo L.

Katedry i Kliniki Dermatologii Slaskiej Akademii Medycznej w Katowicach.

Het doel van de studie was het klinische en trichological die onderzoek (trichogram en de evaluatie van het haarverlies) betrekkelijk before and after de behandeling in 46 vrouwen tussen pubescence en 30 jaar oud wordt geleid die symptomen van diffuse alopecia hadden. Calciumpantothenate werd beheerd twee keer per dag mondeling in dosissen 100 mg 4-5 maanden. De vitamine B6 werd ingespoten elke dag (I-intramusculary ampul) voor de periode van 20 tot 30 dagen en werd herhaald opnieuw na 6 maand. Op basis van klinische en trichological studies die openbaarde men dat vitamine B6 parenteraal voor een periode van verscheidene weken wordt de beheerd verbetering van de haarvoorwaarde in een aantal vrouwen veroorzaakt en het vermindert het haarverlies vooral in alopecia van telogenic patomechanism. Terwijl calciumpantothenate in vrouwelijke diffuse alopecia duidelijk niet het positieve effect toonde.

Mech die Dev verouderen. 2000 20 Dec; 121 (1-3): 251-61.

De opgeheven plasmahomocysteine niveaus in centenarians worden niet geassocieerd met cognitief stoornis.

Ravaglia G, Forti P, Maioli F, Vettori C, Grossi G, Bargossi AM, Caldarera M, Franceschi C, Facchini A, Mariani E, Cavalli G.

Afdeling van Interne Geneeskunde, Cardioangiology, en Hepatology, Universitaire Hospital S. Orsola-Malpighi, via Massarenti 9, 40138 Bologna, Italië. ravaglia@almadns.unibo.it

ACHTERGROND: De vorige verslagen hebben opgeheven plasma totale homocysteine (tHcy) niveaus in bejaarde persoon met geschade kennis getoond. DOELSTELLING: Om de vereniging tussen cognitieve status en plasmathcyniveaus in centenarians te bestuderen. ONTWERP: Onderzoek in dwarsdoorsnede. Het PLAATSEN: Centenarians die in twee noordelijke Italiaanse provincies leven. DEELNEMERS: Dertien cognitively normale centenarians, tien cognitively geschade niet-krankzinnig centenarians, en 34 krankzinnige centenarians met een klinische diagnose van de ziekte van Alzheimer (ADVERTENTIE). METINGEN: Bloedniveaus van homocysteine biologische determinantenvitamine B12, folate, en vitamine B6. VLOEIT voort: De opgeheven niveaus van plasmathcy (>17 micromol/l) waren gemeenschappelijk in de algemene bevolking (77% van normale centenarians, 100% van cognitively geschade niet-krankzinnig centenarians, 82% van ADVERTENTIE centenarians). Krankzinnige centenarians hadden de laagste folate serumniveaus. De het serumniveaus van de lage of grensvitamine B12 (<221 pmol/l) en de lage niveaus van het vitamineb6 plasma (<11.7 nmol/l) werden gevonden in 33 en 66% van alle centenarians onafhankelijk van cognitieve status. Onder krankzinnige centenarians slechts correleerde plasmathcy omgekeerd met zowel serumvitamine B12 als folate. Geen significant verschil werd gevonden voor de niveaus van plasmathcy onder de drie kenmerkende groepen, zelfs daarna het aanpassen B-vitamineniveaus. CONCLUSIES: Hyperhomocysteinemia is zeer gemeenschappelijk onder centenarians, waarschijnlijk wegens vitaminedeficiënties, maar schijnt niet om met cognitief stoornis worden geassocieerd.

Bloed. 2000 15 Dec; 96(13): 4363-5.

Commentaar in: • Bloed. 2001 Jun 15; 97(12): 4000-2. Familie-afgeschuinde x-Chromosoom inactivering als ontvankelijk makende factor voor recent-begin Op sex betrekking hebbende sideroblastic bloedarmoede in dragerwijfjes.

Cazzola M, Mei A, Bergamaschi G, Cerani P, Rosti V, Bischop DF.

Afdeling van Hematologie, Universiteit van de Medische School van Pavia, Italië. m.cazzola@iol.it

De op sex betrekking hebbende sideroblastic bloedarmoede (XLSA) wordt veroorzaakt door veranderingen in het erythroid-specifieke 5 aminolevulinic zure synthase (ALAS2) gen. Een bejaarde dat met een verworven sideroblastic bloedarmoede voorstelde wordt bestudeerd. De moleculaire analyse openbaarde dat zij voor een missense verandering in het ALAS2-gen heterozygous was, maar zij drukte slechts het veranderde gen in reticulocytes uit. Haar 2 dochters en een kleindochter waren heterozygous voor deze verandering, hadden normale hemoglobineniveaus, en drukten het normale ALAS2-gen in reticulocytes uit. Een kleinzoon met een vorige diagnose van thalassemia intermedia werd gevonden hemizygous om voor de ALAS2-verandering te zijn. De behandeling met pyridoxine verbeterde volledig de bloedarmoede zowel in proband als haar kleinzoon. Alle vrouwen die in deze familie werden geanalyseerd toonden skewed x-Chromosoom inactivering in witte bloedlichaampjes, die op een erfelijke voorwaarde verbonden aan uit zijn evenwicht gebrachte lyonization wezen. Omdat het bij voorkeur actieve X-chromosoom mutantalas2 allele droeg, verwierf het afschuinen in bejaarde waarschijnlijk verergerde de genetische voorwaarde en afschafte de normale ALAS2-allele uitdrukking in proband. (Bloed. 2000;96:4363-4365)

Eur J Clin investeert. 2000 Dec; 30(12): 1083-9. Rol van homocysteine, cystathionine en methylmalonic zure meting voor diagnose van binnen hoog-verouderd van de vitaminedeficiëntie onderwerpen.

Herrmann W, Schorr H, Bodis M, Knapp JP, Muller A, Stenen bierkroes G, Geisel J.

Het universitaire Ziekenhuis van het Saarland, Homburg/Saar, Duitsland. kchwher@med-rz.uni-sb.de

ACHTERGROND: Intracellular B-Vitamine en folate deficiëntie door hyperhomocysteinemia wordt vermeld zijn zeer frequent in de bejaarde bevolking die. Hyperhomocysteinemia verhoogt het risico van atherothrombotic ziekten en neuropsychiatric complicaties. Ons doel was het overwicht van verhoogde serummetabolite concentraties bij onderwerpen van een hogere leeftijd te evalueren, en of de meting van metabolite concentraties efficiënter is in het diagnostiseren van B-Vitamine deficiëntie dan zuivere homocysteine. MATERIALEN EN METHODES: Homocysteine (HCY), cystathionine (CYS) en het methylmalonic zuur (MMA) werden onderzocht in serum samen met vitamine B-12, B-6 en folate in 90 hoog-verouderde onderwerpen (85-102 jaar), 92 oudsten (65-75 jaar), en bij 50 jongere onderwerpen (19-50 jaar). VLOEIT voort: De bejaarde (hoog-verouderd en hogere) onderwerpen hadden serumconcentraties van metabolites opgeheven. De hoog-verouderde onderwerpen hadden een hogere frequentie van pathologische verhogingen dan oudsten: HCY 62% versus 24%; MMA 62% versus 23%; CYS 81% versus 36%. Folate en vitamine B-6 waren concentraties beduidend verminderd in beide bejaarde groepen; vitamine B-12 was slechts verminderde binnen hoog-verouderde onderwerpen. Gebruikend vitamine B-6, B-12 en folate voor diagnose van intracellular vitaminedeficiëntie, was het tarief 30% in oudsten en 55% bij hoge oude onderwerpen. Nochtans, gebruikend metabolites (HCY, MMA en CYS) voor de diagnose van intracellular vitaminedeficiëntie, was er een duidelijk verhoogd tarief van 55% in oudsten respectief aan 90% binnen hoog-verouderde onderwerpen. De achterwaartse veelvoudige regressieanalyse openbaarde dat slechts folate, MMA, de creatinine en de leeftijd onafhankelijke variabelen die de HCY-concentratie beïnvloeden waren. Voorts werd de MMA-concentratie beduidend en onafhankelijk beïnvloed door folate, vitamine B-12, HCY en creatinine, en de serumconcentratie van CYS door vitamine B-12, creatinine en leeftijd. CONCLUSIE: Metabolites HCY, MMA en CYS zijn gevoelige indicatoren diagnostiserend geschade remethylation van homocysteine aan methionine met parallelle activering van katabole weg. Vergeleken bij zuivere HCY of B-Vitaminen in serum, stijgt de efficiency van het diagnostiseren van een gestoord HCY-metabolisme zeer in het gebruiken van metabolites HCY, MMA en CYS. Voor differentiële diagnose, worden de parallelle meting van folate en de creatinine geadviseerd. De vroege en correcte diagnose van B-Vitamine deficiëntie bij bejaarde onderwerpen is van hoge klinische relevantie.

Int. Angiol. 2000 Dec; 19(4): 369-72.

Uitgebreide diepe adertrombose in een jonge vrouw. Gevalrapport.

DE Backer T, Voet J, DE Buyzere M, Vertongen P, Tsjoen G, Duprez D, Clement D.

Ministerie van Cardiologie, Dijkzigt Ziekenhuis, Erasmus University, Rotterdam, Nederland.

Wij melden een geval van een jonge dame met een uitgebreide diepe die adertrombose (DVT) door CT aftasten en duplexultrasone klankonderzoek wordt gediagnostiseerd. De medebepalende factoren waren relatieve immobilisatie, mondelinge contraceptie en hyperhomocysteinemia na methionine lading. Geen andere thrombophilic factoren zouden kunnen worden gevonden. De drie belangrijke oorzaken van hyperhomocysteinemia zijn genetische tekorten, voedingsdeficiënties en ontoereikende verwijdering. In ons geval kan een genetisch tekort voor één van de belangrijkste enzymen van homocysteine metabolisme, de onderliggende oorzaak zijn. Naast het tegenhouden van mondelinge contraceptieve drugs, waren de antistolling en de aanvulling met pyridoxine en folate begonnen. Het familieonderzoek werd uitgevoerd en openbaarde andere leden met hyperhomocysteinemia. Of de therapie met pyridoxine en folate de herhaling van aderlijke thromboembolic ziekte kan wezenlijk verminderen moet nog worden gevestigd.

Postgradmed J. 2000 Dec; 76(902): 791-3. Het syndroom van Reiter na intravesical BCG-immunotherapie.

Hogarth MB, Thomas S, Seifert MH, Tariq SM.

Afdeling van Reumatologie, St Mary het Ziekenhuis, Praed-Straat, Londen W2 1NY, het UK.

Een 71 éénjarigenvrouw ontwikkelde bindvliesontsteking, asymmetrische oligoarthritis, en cystitis (het syndroom van Reiter) secundair aan intravesical BCG-behandeling voor overgangscelcarcinoom van de blaas. Zij ontving mondelinge prednisolone, izoniazid, en pyridoxine en maakte een volledige terugwinning. Het stijgende gebruik van BCG als immunotherapie zal leiden tot een verhoging van de weerslag van BCG bijbehorende reactieve artritis. De snelle erkenning en de vroege diagnose zullen behandeling en terugwinning vergemakkelijken.

Br J Nutr. 2000 Nov.; 84 supplement 1: S155-9. Bioactivee substanties in melk met eigenschappen die risico van hart- en vaatziekten verminderen.

Pfeuffer M, Schrezenmeir J.

Federaal ZuivelOnderzoekscentrum, Ministerie van Fysiologie en Biochemie van Voeding, Kiel, Duitsland. pfeuffer@bafm.de

De melk wordt vaak gezien als potentiële promotor van atherosclerose en coronaire hartkwaal omdat het een bron van cholesterol en verzadigde vetzuren is. Maar er zijn verscheidene studies erop wijzen die dat de melk en de zuivelproducten bloedlipiden kunnen ongunstig niet beïnvloeden zoals van zijn vetgehalte en vette samenstelling worden voorspeld. Er zijn zelfs factoren in melk en zuivelproducten die actief tegen deze voorwaarde kunnen beschermen door verscheidene risicofactoren te verbeteren. Het calcium, bioactivee peptides en tot hiertoe niet geïdentificeerde componenten in volle melk kan tegen hypertensie beschermen, en folic zuur, vitamine B6 (pyridoxine) en B12 (cyanocobalamin) of andere niet geïdentificeerde componenten van afgeroomde melk kunnen tot lage homocysteine niveaus bijdragen. Het vervoegde linoleic zuur kan hypolipidaemic en antioxidative en zo antiatherosclerotic eigenschappen hebben. De epidemiologische studies suggereren dat de melk en de zuivelproducten goed in een gezond het eten patroon passen die graangewassen en groenten benadrukken.

Endocr Pract. 2000 nov.-Dec; 6(6): 435-41.

Hyperhomocysteinemia in type - mellitus diabetes 2: cardiovasculair risicofactoren en effect van behandeling met folic zuur en pyridoxine.

Baliga BS, Reynolds T, Fink LM, Fonseca VA.

Afdeling van Pathologie, Universiteit van Arkansas voor Medische Wetenschappen en het Medische Centrum van VA, Little Rock, Arkansas, de V.S.

DOELSTELLING: Om te bepalen of hyperhomocysteinemia (HH) andere cardiovasculaire risicofactoren en tellers van coagulatie en hemostasis in patiënten met type - mellitus diabetes 2 (DM) verergert en of de behandeling van HH met vitaminen deze risicofactoren zal veranderen. METHODES: Wij maten verscheidene cardiovasculaire risicofactoren en tellers van coagulatie en hemostasis in patiënten met type - 2 DM met en zonder HH. Wij behandelden ook patiënten met type - 2 DM en coëxistente HH met hoge dosissen folic zuur en pyridoxine om te bepalen of deze behandeling plasma totale homocysteine concentraties zou verminderen evenals andere bijbehorende cardiovasculaire risicofactoren in deze bevolking zou verbeteren. VLOEIT voort: De plasmaniveaus van plasminogen activator inhibitortype 1 en fibrinogeen waren beduidend hoger in alle patiënten met DM in vergelijking met controleonderwerpen (P<0.01), of zij HH of niet hadden. Geen significant verschil werd genoteerd tussen de twee groepen patiënten met DM. De aanwezigheid van hypertensie en microalbuminuria leidde niet tot hogere plasma totale homocysteine. Na behandeling met folic zuur, 15 mg dagelijks, en pyridoxine, 600 mg dagelijks, het vasten (basis) plasma totale homocysteine daalde beduidend in patiënten met DM van 12.3 +/- 2.9 micromol/L tot 9.1 +/- 1.1 micromol/L (P<0.01). Piek het plasma totale homocysteine van de post-methioninelading in de patiënten met DM verminderde van 39.9 +/- 11.4 micromol/L aan 30.4 +/- 6.5 micromol/L (P<0.05). Noch vastende noch piekplasma totale die homocysteine bij normale onderwerpen wordt veranderd. Niets van het cardiovasculaire risico calculeert gemeten beduidend veranderd met de vitaminebehandeling in. CONCLUSIE: De coëxistentie van type - 2 DM en HH leiden niet tot een verergering van abnormaliteiten in de gemeten variabelen van coagulatie en hemostasis. De behandeling met hoge dosissen folic zuur en pyridoxine vermindert beduidend plasma totale homocysteine maar verbetert om het even welke bijbehorende cardiovasculaire risicofactoren niet die wij maten. De klinische proeven op lange termijn zouden moeten worden geleid om te bepalen of de behandeling van de hoog-dosisvitamine de verhoogde morbiditeit en de mortaliteit verbonden aan hart- en vaatziekte in patiënten met type - 2 DM zal verminderen.

Boog Neurol. 2000 Oct; 57(10): 1422-7. Homocysteine en neurologische ziekte.

Diaz-Arrastia R.

Afdeling van Neurologie, Universiteit van Texas Southwestern Medical Center, 5323 Harry Hines Blvd, Dallas, TX 75390-9036. RdiazA@mednet.swmed.edu.

In de loop van de laatste 10 jaar, is er een explosie van belang in homocysteine, een zwavelhoudend aminozuur geweest dat een centrale plaats in de metabolische wegen van thiolsamenstellingen bezet. Deze rente is hoofdzakelijk wegens de totstandbrenging dat hyperhomocysteinemia een belangrijke risicofactor voor vaatziekte, met inbegrip van slag is, onafhankelijk van lang-erkende factoren zoals mellitus, en hyperlipidemia, hypertensie die, diabetes roken. Sinds opgeheven homocysteine kunnen de niveaus vaak worden genormaliseerd door het dieet met folic (folate) aan te vullen zuur, pyridoxinewaterstofchloride (vitamine B (6)), en cyanocobalamin (vitamine B (12)), heffen deze observaties de opwindende mogelijkheid dat deze op goedkope en goed-getolereerde therapie efficiënt kan zijn in het verminderen van de weerslag van vaatziekte. Naast zijn vereniging met hersenziekte, kan homocysteine een rol in neurodegenerative wanorde spelen, zelfs als slechts als teller van functionele vitamineb (12) deficiëntie. Homocysteine is ook belangrijk voor neurologen aangezien de meeste middelen tegen stuipen homocysteine niveaus, een effect verhogen dat de teratogenic gevolgen van deze drugs kan verklaren. De praktische kennis betreffende sommige details van homocysteine metabolisme, diagnose van hyperhomocysteinemia, en het gebruik van polyvitamintherapie op zal lagere homocysteine niveaus in de behandeling van patiënten met neurologische ziekte meer en meer belangrijk zijn. Boog Neurol. 2000;57:1422-1428

Indisch J Pediatr. 2000 Oct; 67(10): 725-8.

Homocystinuria met aangeboren/ontwikkelingscataract.

Sulochana KN, Amirthalakshmi S, Vasanthi-Sb, Tamilselvi R, Ramakrishnan S.

De Afdeling van het biochemieonderzoek, Medisch Onderzoekstichting, Sankara Nethralaya, Chennai, India.

Het doel van de studie is aan het schermpatiënten voor homocystinuria met en zonder cataract en analyseert voor homocystine en methionine. Achtenvijftig steekproeven van 29 patiënten, d.w.z., plasma en urine verzamelden nadat 's nachts vastend door de onderzoekstest voor homocystine, en document chromatografie voor homocystine en methionine werden geanalyseerd. Van de 29 homocystinuric patiënten, hadden 24 cataract. Slechts had men merkbare hoeveelheden methionine in zijn serum. Hij had ook geestelijke vertraging zoals verwacht en behoort tot Type I. De andere types hadden geen methionine maar hadden slechts homocystine. Er waren geen geestelijke vertraging of ectopia lentis. Zo behoorden zij tot Types II, III of IV. Aangezien er bovenmatige methionine in Type I, met laag cystine zijn, kan de cataract aan deficiëntie van cysteine en verminderde glutathione toe te schrijven zijn en zou door geschikte therapie kunnen worden voorkomen, d.w.z., hoog cystine-laag methionine dieet met B6. In andere types met lage methionine, kan de cataract aan verminderde beschikbaarheid van aminozuren voor de synthese van lensproteïnen toe te schrijven zijn; de behandeling van keus zou B12, en folate met methionine moeten zijn.

J Ren Nutr. 2000 Oct; 10(4): 196-201. Folic zure en pyridoxal-5'-fosfaat verliezen tijdens hoog rendementhemodialyse in patiënten zonder hydrosoluble vitamineaanvulling.

Leblanc M, Pichette V, Geadah D, Ouimet D.

Nefrologie en Biochemieafdeling, het Ziekenhuis maisonneuve-Rosemont en Guy-Bernier Research Center, Universiteit van Montreal, Montreal, Canada.

DOELSTELLINGEN: Om de serumstatus in folate te bepalen, bewogen het pyridoxal-5'-fosfaat (het actieve deel van pyridoxine), cobalamin, en totale homocysteine van chronische die dialysepatiënten niet uit routine met B-Complexe vitaminen wordt aangevuld en te evalueren tot intradialytic verliezen tijdens hoog rendementhemodialyse. ONTWERP: Een studie in dwarsdoorsnede. Het PLAATSEN: Een universitair medisch centrum die tertiaire zorg verstrekken. PATIËNTEN: Zesendertig chronische dialysepatiënten (23 mannen en 13 vrouwen, bedoelen leeftijd 57+/13 jaar) behandelden sinds 3.8+/2.2 jaar door hemodialyse en aangevuld niet met hydrosoluble vitaminen. METHODES: De driemaal-wekelijkse hemodialyse werd uitgevoerd gebruikend ct-190G (Baxter, IL) of F-20 (Hospal, st-Leonard, Canada) gebruikten dialyzers met een gemiddeld tarief van de bloedstroom van 371+/40 mL/min, een dialysate stroomtarief van 500 mL/min, en een gemiddelde zittingstijd van opnieuw 3.7+/0.4 uren. De vitamine B van het Prehemodialysisserum (12) werden en homocysteine, en predialysis en postdialysisserumfolate, het pyridoxal-5'-fosfaat, en het ureum gemeten. Bloed-zij folate en de pyridoxal-5'-fosfaat ontruiming werd berekend. VLOEIT voort: Totale was homocysteine van het Predialysisserum boven normaal in alle patiënten, met waarden die zich van 14.4 tot 158.0 micromol/L uitstrekken (beteken 40.2+/29.6 micromol/L, mediaan 33.5 micromol/L). Terwijl de meerderheid, 21 patiënten, bewijsmateriaal van coronaire, hersen, en/of randvaatziekten had, was er geen verschil in totale homocysteine in patiënten met of zonder vaatziekte (respectievelijk, 40.8+/37.0 micromol/L v 39.4+/15.1 micromol/L, P = NS). De concentraties van het Predialysisserum van pyridoxal-5'-fosfaat werden verminderd in 20 patiënten (56%) en waren in de lagere normale waaier voor 14 patiënten. Predialysis en postdialysis waren de serum folate concentraties 12.4+/6.1 nmol/L en 8.6 +/- 3.6 nmol/L, terwijl predialysis en postdialysisserum de pyridoxal-5'-fosfaat concentraties 11.1+/7.5 nmol/L en 8.0 +/5.9 nmol/L. waren. De verhoudingen van de percentenvermindering waren 68.4% +/- 6.6% voor ureum, 26.3%+/16.0% voor folates, en 27.9%+/14.2% voor pyridoxal-5'-fosfaat. De bloed-zijontruiming bereikte 134.7+/22.2 mL/min voor folates en 54.4+/38.2 mL/min voor pyridoxal-5'-fosfaat. Er was geen significant verschil in folate en het pyridoxal-5'-fosfaat van het predialysisserum in patiënten met of zonder bewijsmateriaal van vaatziekte. CONCLUSIE: Deze studie bevestigt dat: (1) de totale serumhomocysteine niveaus zijn zeer hoog in chronische die hemodialysepatiënten niet met B-Complexe vitaminen worden aangevuld; (2) folate wordt beduidend ontruimd of tijdens hoog rendementhemodialyse verloren; en (3) het pyridoxal-5'-fosfaat, het actieve deel van pyridoxine, wordt uitgeput in de meeste chronische hemodialysepatiënten zonder aanvulling en die hoog rendementhemodialyse draagt tot zijn uitputting bij. Copyright 2000 door de Nationale Nierstichting, Inc.

Med Hypotheses. 2000 Oct; 55(4): 289-93. Gestegen homocyst (e) ine geassocieerd met het roken, chronische ontsteking, en het verouderen kan scherp-fase op inductie van pyridoxal phosphatase activiteit wijzen.

McCartymf.

Pantoxlaboratoria, San Diego, CA 92109, de V.S.

De rokers, patiënten met chronische ontstekingswanorde, en de bejaarden, worden gekenmerkt door gestegen productie van IL-6 evenals verhoogde plasmaniveaus van homocyst (e) ine. De analyse van cirrhotic levers stelt voor dat IL-6 de activiteit van pyridoxal phosphatase in hepatocytes kunnen bevorderen, daardoor verminderende pyridoxal fosfaatniveaus, het compromitteren de activiteit van cystathionine bèta-synthase, en het opheffen van plasma homocyst (e) ine. De adequate supplementaire opnamen van pyridoxine kunnen in dit verband correctief zijn. Copyright 2000 Harcourt Publishers Ltd.

Wei Sheng Wu Xue Bao. 2000 Oct; 40(5): 528-34.

[De belangrijke rol van vitaminen in de overproductie van pyruvic zuur]

[Artikel in Chinees]

Li Y, Chen J, Lun S, Rui X.

Laboratorium van Milieubiotechnologie, School van Biotechnologie, Wuxi-Universiteit van Lichte Industrie, Wuxi 214036.

Het effect van nicotinezuur, thiamine, pyridoxine, biotine en riboflavine op de productie van pyruvic zuur door Torulopsis glabrata wsh-IP303 met glucose als koolstofbron en NH4Cl als enige stikstofbron werd onderzocht. Door orthogonal experimentmethode te gebruiken, werd de thiamine bevestigd om de belangrijkste factor te zijn die de productie van pyruvic zuur beïnvloeden. Gebaseerd op een bepaalde concentratiewaaier van thiamine (0.01-0.015 mg/l), kan het tarief van de glucoseconsumptie worden verbeterd door de concentratie van nicotinezuur te verhogen. Toen de concentratie van nicotinezuur, de thiamine, het pyridoxine, de biotine en de riboflavine 8 waren, bereikten 0.015, 0.4, 0.04 en 0.1 mg/l, respectievelijk, de concentratie en de opbrengst aan glucose van pyruvic zuur 52.4 g/L en 0.525 g/g om 48 h in flescultuur, respectievelijk. De partijcultuur werd geleid in een 2.5 l-gister met aanvankelijke glucoseconcentratie van 120 g/l. Door de optimale concentratiecombinatie vitaminen goed te keuren, bereikten de concentratie en de opbrengst aan glucose van pyruvic zuur 69.4 g/L en 0.593 g/g om 57.5 h, die met 32.4% en 13% dan de beste resultaten in flescultuur, respectievelijk werden verhoogd.

Tidsskr noch Laegeforen. 2000 20 Sep; 120(22): 2648-53.

[Voeding, dieetaanvulling en coronaire hartkwaal]

[Artikel in Noor]

Oriëntatiepunt K, Reikvam A.

Institutt voor farmakoterapi, Oslo. k.h.landmark@ioks.uio.no

ACHTERGROND: Tijdens het laatste decennium, zijn de verminderings van lipidenagenten, in het bijzonder statins, meer en meer belangrijk in de behandeling van hart- en vaatziekten en dyslipidaemias geworden. Dit zou kunnen impliceren dat de nadruk op dieet en de supplementaire voedingsmiddelen geen voldoende aandacht krijgen. MATERIAAL EN METHODES: Op basis van studies van de literatuur, wordt de wetenschappelijke documentatie voor een mogelijk gunstig effect van de volgende elementen herzien: opname van vet, vissen en vistraan, alpha--linolenic zuur, folic zuur, vitamine B6 en vitamine B12, noten, installatiesterol en psyllium. VLOEIT voort: De verminderde opname van verzadigd vet veroorzaakt verbetering van de waarden van het serumlipide en verhindert cardiovasculaire gebeurtenissen. De opname van vissen, vissenoliën en alpha--linolenic zuur heeft positieve gevolgen voor verscheidene klinische eindpunten, vaak zonder duidelijke daling van serumcholesterol. Homocysteine schijnt een onafhankelijke risicofactor voor hart- en vaatziekten te zijn, maar een oorzakelijke verhouding moet nog worden bewezen. Het cofactoren folic zuur, vitamine B6 en B12 vermindert het homocysteine niveau, maar de gevolgen van deze interventie voor harde klinische eindpunten ontbreken. Er zijn aanwijzingen dat de opname van noten coronaire gebeurtenissen kan verhinderen. De installatiesterol en psyllium in het dieet verminderen cholesterolniveaus. INTERPRETATIE: Aldus, is de dieetinterventie belangrijk in de preventie en de behandeling van coronaire hartkwaal. Ook wanneer de drugbehandeling wordt vermeld, is een nadruk op dieet en voedende aanvulling hoogst gerechtvaardigd. Sommige voedingsmiddelen kunnen preventief effect met betrekking tot coronaire gebeurtenissen, ondanks hun klein effect op cholesterolniveaus hebben.

J Internmed. 2000 Sep; 248(3): 223-9. Het effect van verschillende behandelingsregimes in het verminderen het vasten en postmethionine-lading homocysteine concentraties.

van der Griend R, Biesma DH, Haas FJ, Faber JA, Duran M, Meuwissen-PB, Banga JD.

Ministeries van Interne Geneeskunde en Klinische Chemie, Sint Antonius Hospital, Nieuwegei, Nederland.

DOELSTELLINGEN: Om het homocysteine-verminderend effect te bepalen van verschillende behandelingsregimes op zowel het vasten als postmethionine-lading plasma totale homocysteine (tHcy) concentraties. ONTWERP: Beschrijvende studie van opeenvolgende hyperhomocysteinaemic onderwerpen per behandelingsregime. Homocysteine werd gemeten in de vastende staat en 6 h na methionine lading, beide vóór en na 8 weken van vitaminetherapie. Hyperhomocysteinaemia werd gedefinieerd als het vasten tHcy en/of verhoging die van tHcy (postmethionine-lading minus het vasten tHcyconcentratie) 95ste percentile van lokale controles overschrijden. Het PLAATSEN: Polikliniek van interne geneeskunde van het groot non-academic het onderwijsziekenhuis. ONDERWERPEN: Honderd zeventien hyperhomocysteinaemic onderwerpen (vasculaire patiënten en eerste-graadverwanten). ACTIES: Er waren vier regimes: pyridoxine, 200 mg; folic zuur, 5 mg; combinatie van folic zure 0.5 mg en pyridoxine 100 mg; en folic zuur, 0.5 mg dagelijks. VLOEIT voort: Alle regimes, behalve pyridoxine 200 mg, verminderden het vasten beduidend tHcy zonder verschillen in de percentagevermindering (32-38%). Alle regimes veroorzaakten een significante vermindering van de verhoging van tHcy en postmethionine-lading tHcy. De vermindering van postmethionine-lading tHcy was kleiner voor pyridoxine 200 mg dan voor combinatietherapie. Geen verschillen werden gevonden in de percentagevermindering (voor zowel verhoging van tHcy als postmethionine-lading tHcy) tussen folic zure 5 mg en folic zure 0.5 mg. CONCLUSIES: Is het Monotherapy folic zuur (0.5 mg dagelijks) de laagste efficiënte therapie voor het verminderen van zowel het vasten als postmethionine-lading tHcyconcentraties, met dezelfde resultaten zoals hoog-dosis folic zuur (5 mg dagelijks). Het pyridoxine heeft geen extra waarde.

Mol Cell Biochem. 1999 Juli; 197 (1-2): 79-85.

Vermindert het vitamine b6-Ontoereikende dieet plus deoxypyridoxine 4 (4-DPD) de ontstekingsdiereactie door T.-spiralis in diafragma, masseter en het weefsel van de hartspier van muizen wordt veroorzaakt.

Frydas S, Papaioanou N, Vlemmas I, Theodoridis I, Anogiannakis G, Vacalis D, Trakatellis A, Barbacane RC, Reale M, Conti P.

Immunologieafdeling, Universiteit van de School van Chieti van Geneeskunde, Italië.

De dieren gevoed diëten ontoereikend in vitamine B6 ontwikkelen microcytic bloedarmoede, wijzigingen van de groei, en andere pathologie. 4-deoxypirydoxine is een machtige antagonist van vitamineb6 coenzyme die IL-1, TNF en IL-6 indrukt en anti-inflammatory eigenschappen heeft. Het doel van deze studie was de anti-inflammatory gevolgen te tonen van 4-DPD bij de chronische die ontsteking door spiralis van de draadwormparasiet T., specifiek op de rekrutering en de activering van ontstekingscellen wordt veroorzaakt. Twee groepen muizen, 6 weken van leeftijd, werden gebruikt: werd gehandhaafd op een dieet van de vitamine b6-Ontoereikend synthetisch korrel 15 dagen vóór injectie van de draadworm, en beheerde een intraperitoneal injectie (i.p.) van 4-DPD (250 microg/muis) 15 dagen (de eerste, 5 dagen vóór besmetting), en de tweede groep werd gehandhaafd op een normale voeding voor de totale duur van het experiment. Deze twee groepen werden toen per os ingespoten met 150 larven (L1-T7-spiralis). De chronische ontsteking werd veroorzaakt door besmetting van behandelde of onbehandelde muizen met T7 spiralisparasiet. Na 14 dagen post-besmetting ontwikkelden alle muizen een chronische ontstekingsreactie. De muizen met een b6-Ontoereikend dieet worden gevoed toonden een significante die daling van het aantal cysten in het diafragma wordt wanneer vergeleken die bij muizen met normale voeding worden behandeld gevonden die. Bovendien in alle die muizen met vitamine b6-Ontoereikend dieet worden behandeld plus 4-DPD was het gemiddelde lichaamsgewicht beduidend lager, vergeleken bij de muizen op normale voeding in alle onderzochte weken. Voorts in secties van het diafragma, masseter en myocardium waren de spieren, de infiltratie van ontstekingscellen, zoals macrophages, lymfocyten, en eosinophils intenser in onbehandelde muizen in vergelijking met die voedden een vitamine b6-Ontoereikend dieet. Deze resultaten tonen aan dat BALB/c-de muizen met T.-spiralis besmetten en een vitamine b6-Ontoereikend dieet plus de vitamineb6 antagonist voedden, 4-DPD, verlengen de tijd van invasie van de larven in de spiercellen, beïnvloeden de rekrutering van ontstekingscellen en de intensiteit van de ontstekingsreactie in vergelijking met besmette onbehandelde muizen (controle).

Nutr Hosp. 1999 juli-Augustus; 14(4): 164-9.

[Aanpassing van het gemiddelde die dieet door de Valencian Liefdadigheidsvereniging aan de voedingsaanbeveling voor de volwassen bevolking wordt aangeboden]

[Artikel in het Spaans]

Farre Rovira R, Frasquet-Bruggen I, Martinez Martinez MI.

Facultat DE Farmacia, Universitat DE Valencia, Algemene Estudi, Espana.

Om verscheidene redenen, in industrielanden als van ons, is er een groeiend aantal mensen die institutionele of privé hulp om vereisen te overleven. De Valencian Liefdadigheidsvereniging heeft een vrije het dineren zaal voor meer dan 300 mensen sinds 1906 in werking gesteld, die lunch (2 cursussen, brood, fruit, en een zuivelproduct) en een sandwichdiner dient. De doelstelling van deze die studie is de graad van aanpassing van het dieet te evalueren aan de voedingsbehoeften van zij wordt aangeboden die daar eten. Voor dit, berekenden wij de hoeveelheden elk van het voedsel inbegrepen in een maandelijks die menu, in g of ml per persoon per dag worden uitgedrukt, en deze worden omgezet in energievoorziening en voedingslevering, en deze worden dan vergeleken bij de geadviseerde opname van de Spaanse bevolking. De menu's verstrekten, nagedacht om de enige dieetopname van die te zijn die, proteïnen, thiamine, cyanocobalamine, retinol, en vitamine C in bedragen daar eten te verstrekken die of groter gelijkaardig zijn dan die geadviseerd voor zowel geslachten als alle leeftijdsgroepen, terwijl het zink, het magnesium, het pyridoxine, folates, en de tocoferolhoeveelheden minder dan 54% van de geadviseerde opname voor de groepen met de grootste behoeften zijn (adolescenten of zwangere of melk afscheidende vrouwen). Aanvullend het basisdieet met een ontbijt (glas volle melk met suiker en van Maria koekjes), zouden een yoghurt, een gedeelte droge vruchten, en een gedeelte van fruit voor diner, de levering van magnesium, folates, en vitamine E tot niveaus die aan de behoeften van het behoeftigst, die van zwangere en melk afscheidende vrouwen voldoen, maar de niveaus van pyridoxine zouden blijven laag, enkel als in andere studies verhogen, en de geadviseerde hereof opnameniveaus lijken onbereikbaar zelfs als dit dieet met voedingsmiddelen wordt aangevuld die gemakkelijk door deze bevolkingsgroep kunnen worden betreden.

Een in het bijzonder Pediatr. 1999 Jun; 50(6): 576-80.

[De voordelen en de risico's om dieetdierichtlijnen te volgen op het verminderen van cardiovasculair risico van kinderjaren worden gericht]

[Artikel in het Spaans]

Ortega Anta RM.

Departamento DE Nutricion, Facultad DE Farmacia, Universidad Complutense, Madrid.

DOELSTELLING: De laatste jaren is veel aandacht gegeven aan de mogelijkheid om vroegrijpe dieetaanbevelingen te vestigen die zouden kunnen helpen het risico van hart- en vaatziekte later in het leven verminderen. Het doel van het huidige overzicht is de mogelijke risico's te analyseren verbonden aan dergelijke praktijken. VLOEIT voort: Sommige auteurs stellen voor dat de beperking van totale vet, verzadigd vet en cholesterolopname tot voedingsonevenwichtigheid en deficiënties in mineralen en vitaminen, vooral in vet oplosbaar vitaminen, pyridoxine, riboflavine, calcium, zink, ijzer, jodium en magnesium zou kunnen leiden. Het zou ook met veranderingen in de groei en de ontwikkeling van kinderen, verhoogd risico van hart- en vaatziekte en mortaliteit kunnen worden geassocieerd toe te schrijven aan andere oorzaken. Alle auteurs en organisaties zijn het ermee eens dat in kinderen, de principedoelstelling zou moeten zijn dat het dieet de correcte hoeveelheden energie en voedingsmiddelen verstrekt opdat hen de optimale groei en ontwikkeling bereiken. Met betrekking tot de preventie van hart- en vaatziekte, zou het best schijnen dat een langzame overgang van de hoogte - vette opname van vroege kleutertijd aan die geadviseerd in het volwassen leven voorkomt (minder dan 30% van energie van vetten, minder dan 10% van verzadigd vet en minder dan 300 mg/dag-cholesterol). CONCLUSIES: In het algemeen zou een overgangsstadium met een geleidelijke die daling van de hoeveelheid vet moeten worden respecteerd tussen de leeftijd van twee jaar en het eind van de de groeiperiode wordt verbruikt. Wanneer de beperkingsdiëten absoluut noodzakelijk zijn, zouden hun criteria zorgvuldig moeten worden overwogen. De voedingsstatus van kinderen na dergelijke diëten zou moeten worden gecontroleerd zodat de bestrijding van hart- en vaatziekte geen voedingsdeficiënties met terugslag gelijkend op conditioneert, of zelfs ernstiger dan, de voorwaarde die zij zijn bedoeld om te vermijden.

Atherosclerose. 1999 Jun; 144(2): 419-27. Het anti-oxyderend, maar niet de B-groepvitaminen verhogen de weerstand van lipoprotein met geringe dichtheid tegen oxydatie: een willekeurig verdeeld, factorontwerp, placebo-gecontroleerde proef.

Woodsidejv, Jongelui IS, Yarnell JW, Roxborough HIJ, McMaster D, McCrum EE, Gey KF, Evans A.

School van Klinische Geneeskunde, de Universiteit van de Koningin van Belfast, Noord-Ierland, het UK.

Wij hebben een interventieproef geleid om de gevolgen te beoordelen van anti-oxyderend en B-groepvitaminen voor de gevoeligheid van lipoprotein met geringe dichtheid (LDL) aan oxydatie. Een totaal van 509 mensen op de leeftijd van 30-49 van een lokaal aantal arbeidskrachten werden onderzocht voor totale plasmahomocysteine. De 132 geselecteerde (homocysteine concentratie > of = 8.34 mumol/l) mensen werden willekeurig toegewezen, gebruikend een factorontwerp, aan één van vier groepen die aanvulling met alleen B-groepvitaminen (1 mg folic zuur, 7.2 mg pyridoxine, 0.02 mg-cyanocobalamin) ontvangen, anti-oxyderende vitaminen (150 mg ascorbinezuur, 67 mg-alpha--tocoferol, 9 mg-beta-carotene), B-vitaminen met anti-oxyderende vitaminen, of placebo. De interventie was dubbelblind. Een totaal van 101 mensen rondden de studie af van 8 weken. De vertragingstijd van LDL ex vivo aan oxydatie wordt geïsoleerd (door 2 mumol/l koperchloride wordt veroorzaakt) werd in de twee groepen verhoogd die anti-oxyderend hetzij met (6.88 +/- 1.65 min) ontvangen of zonder (8.51 +/- 1.77 die min) B-Vitaminen, met placebo (- 2.03 +/- 1.50) worden vergeleken of alleen B-Vitaminen (- 3.34 +/- 1.08) (Gemiddelde +/- S.E., P < 0.001 die). De antilichamen aan malondialdehyde (MDA) werden gewijzigde LDL ook gemeten, maar er waren geen significante veranderingen in titers van deze antilichamen in om het even welke groep onderwerpen of of niet ontvangend anti-oxyderend. De contrastanalyse toonde aan dat er geen interactie tussen anti-oxyderend en B-groepvitaminen was. Deze studie wijst erop dat terwijl lagere het plasmahomocysteine van B-groepvitaminen hebben zij geen anti-oxyderend effect. Aldus schijnen het de B-groepvitaminen en anti-oxyderend om afzonderlijke, onafhankelijke gevolgen te hebben in het verminderen van cardiovasculair risico.

Kanker Epidemiol Biomarkers Prev. 1999 Jun; 8(6): 513-8. Methylenetetrahydrofolatereductase, dieet, en risico van dubbelpuntkanker.

Slattery ml, Pottenbakker JD, Samowitz W, Schaffer D, Leppert M.

Universiteit van de Medische School van Utah, Salt Lake City 84108, de V.S.

De individuen met verschillende vormen van het 5.10 methylenetetrahydrofolatereductase (MTHFR) gen, dragers van de C677T-verandering tegenover wild type, tonen verschillen in enzymniveaus; deze verschillen zijn een hypothese opgesteld om op DNA-methylation en, misschien, op de grootte van de nucleotidepool worden betrekking gehad. Gebruikend gegevens van inherente een geval-controle studie, evalueerden wij het gecombineerde effect van dieetopname van folate, methionine, vitamine B6, vitamine B12, en alcohol en diverse vormen van het MTHFR-gen op risico van dubbelpuntkanker. De individuen homozygous voor de verschillende vorm van het MTHFR-gen (TT) hadden een lichtjes lager risico van dubbelpuntkanker dan individuen die wild type waren [CC, kansenverhouding (OF) = 0.8, 95% betrouwbaarheidsinterval (ci) = 0.6-1.1 voor mensen; en OF = 0.9, 95% ci = 0.6-1.2 voor vrouwen]. De hoge niveaus van opname van folate, vitamine B6, en vitamine B12 werden geassocieerd met een vermindering 30-40% van risico van dubbelpuntkanker onder die met TT met betrekking tot die met lage niveaus van opname die het genotype van CC waren. De verenigingen waren sterker voor proximale tumors, waarin de hoge niveaus van opname van deze voedingsmiddelen met het halveren van risico onder die met het TT genotype werden geassocieerd. De omgekeerde vereniging met hoge niveaus van deze voedingsmiddelen in die met het TT genotype was sterker onder die gediagnostiseerd op een oude dag. Hoewel onnauwkeurig, werd de omgekeerde vereniging met het dieet met lage risico's dat in folate en methionine en zonder alcohol hoog was waargenomen voor zowel het TT genotype (OF = 0.4 95% ci = 0.1-0.9) en het CC/CT-genotype (OF = 0.6, 95% ci = 0.4-1.0), maar deze vereniging werd niet gezien met het zeer riskante dieet voor of TT of CC/CT-genotype. Hoewel de verenigingen over het algemeen zwak waren, stellen deze bevindingen voor dat die met verschillende MTHFR-genotypen verschillende die gevoeligheden aan dubbelpuntkanker kunnen hebben, op dieetconsumptie van folate, vitamine B6, en vitamine B12 wordt gebaseerd.

Clin investeert Med. 1999 Jun; 22(3): 106-10.

Overwicht en strengheid van misselijkheid en het braken van zwangerschap en effect van vitamineaanvulling.

Emelianova S, Mazzotta P, Einarson A, Koren G.

Afdeling van Pediatrie, het Ziekenhuis voor Zieke Kinderen, Toronto, Ont.

DOELSTELLING: Hoewel de misselijkheid en het braken van zwangerschap de gemeenschappelijkste medische voorwaarde tijdens zwangerschap zijn, zijn er vele onbeantwoorde vragen betreffende zijn oorzaak, epidemiologische eigenschappen en optimaal beheer. De doelstellingen van deze studie moesten het overwicht nagaan van misselijkheid en het braken in een steekproef van Canadese vrouwen, de distributie van hun strengheid kenmerken en de rol van vitamineb6 deficiëntie in hun etiologie onderzoeken. ONTWERP: Prospectieve studie. Het PLAATSEN: De prenatale adviserende dienst voor zwangere vrouwen. PATIËNTEN: Drie cohorten van vrouwen: een prospectieve, op basis van de bevolking cohort van 193 vrouwen, om het tarief en de strengheid te schatten van misselijkheid en het braken (cohort A); een cohort van 555 vrouwen die naar raad voor misselijkheid met of zonder het braken streefden, om de correlatie tussen het maximale dagelijkse aantal episoden van brakend en maximaal gewichtsverlies (cohort B) te bestuderen; en een prospectieve cohort van 301 vrouwen die het braken meldden, om vitamineaanvulling met het braken (cohort C) te correleren. ACTIES: Alle 3 cohorten werden geïnterviewd tijdens de het adviseren zitting, en de cohort B werd voor de toekomst opgevolgd. RESULTATENmaatregelen: Frequentie van misselijkheid en het braken, gewichtsverlies, maximaal aantal dagelijkse episoden van het braken, tarief van multivitaminaanvulling. VLOEIT voort: Globaal, meldde 67% van de vrouwen in cohort A het ervaren van misselijkheid of het braken, of allebei; 22% het gemelde ervoer braken, en 9% gewichtsverlies. In cohort B was er een significante correlatie tussen het maximale aantal dagelijkse episoden van brakend en maximaal gewichtsverlies, hoewel er groot verschil was (r2 = 0.25, p < 0.001). Er was een hoogst significante correlatie tussen het aantal dagelijkse het braken episoden en betekent gewichtsverlies (r2 = 0.99). In cohort C, werd het braken beduidend geassocieerd met gebrek aan aanvulling met multivitamins vóór de zwangerschap van 6 weken (p = 0.002). CONCLUSIES: De relatie tussen aantal dagelijkse het braken episoden en betekent het gewichtsverlies als klinisch hulpmiddel kan dienen om de strengheid van misselijkheid en het braken in zwangerschap en het succes van anti-emetics en rehydratieregimes te beoordelen. De verdere studie is nodig om de biologische basis van de waargenomen vereniging tussen het braken en gebrek aan multivitaminaanvulling in vroege zwangerschap nader toe te lichten.

J Am Soc Nephrol. 1999 Jun; 10(6): 1287-96. Gevolgen van hoog-dosis folic zuur en pyridoxine voor plasma en erytrocietzwavelaminozuren in hemodialysepatiënten.

Suliman ME, Divino Filho JC, Barany P, Anderstam B, Lindholm B, Bergstrom J.

Afdeling van Klinische Wetenschap, het Universitaire Ziekenhuis van Huddinge, Karolinska-Instituut, Stockholm, Zweden.

In dit onderzoek, werden de zwavelaminozuren (sAA) en sulfhydryls bepaald in het plasma en de erytrocieten (RBC) van 10 uremic patiënten over regelmatige hemodialyse (HD) behandeling en 10 gezonde onderwerpen, before and after aanvulling met 15 mg/d van folic zuur en 200 mg/d van pyridoxine 4 weken. De basis totale plasmaconcentraties van homocysteine (Hcy), cysteine (Cys), cysteinylglycine (cys-Gly), gamma-glutamylcysteine (gamma-Glu-Cys), glutathione (GSH), en vrij cysteinesulfinic zuur (CSA) waren beduidend hoger in HD-patiënten wanneer vergeleken bij gezonde onderwerpen, terwijl (Ontmoet) methionine en taurine (Tau) de concentraties hetzelfde in de twee groepen waren. HD de patiënten toonden beduidend hogere RBC-niveaus van Hcy en cys-Gly, terwijl de RBC-concentraties van Samengekomen, Cys, Tau, en GSH niet verschillend van die bij de gezonde onderwerpen waren. De plasmaconcentraties van sAA en sulfhydryls verschild vergelijkbaar geweest met RBC-niveaus in de gezonde onderwerpen en HD-patiënten. In zowel groepen, verminderden de aanvulling met hoge dosissen folic zuur als het pyridoxine de concentratie van plasmahcy. Bovendien werden de verhoogde plasmaconcentraties van cys-Gly en GSH gevonden in de HD-patiënten en van CSA bij de gezonde onderwerpen. Nadat de vitamineaanvulling, de RBC-concentraties van Hcy, Cys, en GSH steeg en dat van Tau verminderde bij gezonde onderwerpen. Het enige significante vinden in RBC van HD-patiënten was een verhoging van GSH-niveaus na aanvulling. Deze studie toont verscheidene RBC en plasma sAA en sulfhydryl abnormaliteiten in HD-patiënten, dat vroegere bevindingen bevestigen dat RBC en de plasmapools onafhankelijke rollen in interorgan aminozuurvervoer en metabolisme spelen. Voorts verminderde de hoog-dosisaanvulling met folic zuur en pyridoxine Hcy-beduidend niveaus, maar herstelde niet sAA en sulfhydryl abnormaliteiten op normale niveaus. De verhoging die in GSH na vitamineaanvulling werd waargenomen kan een gunstig effect hebben in het verbeteren van bloed anti-oxyderende status in uremic patiënten. Tot slot de bevindingen van de opgeheven niveaus die van plasmacys met de opgeheven niveaus van plasmahcy in aanwezigheid van opgeheven die beide plasmacsa niveaus correleren, vóór en na vitamineaanvulling, tot de hypothese wordt geleid dat een blok in decarboxylation van CSA met hyperhomocysteinemia in eindstadium niermislukking verbonden is.

Pharmacol Toxicol. 1999 Jun; 84(6): 274-80.

Het nicotinezuur en het pyridoxine moduleren in vitro arachidonic zuurmetabolisme en ex vivo bij de mens.

Saareks V, Mucha I, Sievi E, Riutta A.

Afdeling van Farmacologische Wetenschappen, Universiteit van Tampere, Finland.

De gevolgen in vitro van nicotinezuur (microM 10-1000), pyridoxine (microM van 0.1-500) en pyridoxal-5'-fosfaat (microM van 0.1-500) en de ex vivo gevolgen van nicotinezuur (2500 mg mondeling tijdens 12 h) en pyridoxine (600 mg mondeling dagelijks zeven dagen) werden op arachidonic zuurmetabolisme onderzocht in calcium ionophore A23187 (calcimycin) - bevorderd menselijk geheel bloed. Het nicotinezuur in vitro bevorderde prostaglandine E2, thromboxane B2 en leukotriene E4 synthese. Het pyridoxine bij alle concentraties en het pyridoxal-5'-fosfaat bij de hoogste concentratie bevorderden prostaglandine E2 en thromboxane B2 productie, maar hadden geen effect bij de leukotrienee4 synthese. De nicotine zure behandeling verhoogde prostaglandine E2, ex vivo thromboxane B2 en leukotriene E4 synthese tot 185%, 165% en 175% van de aanvankelijke waarden, respectievelijk. Bij de pyridoxine-behandelde onderwerpen, ex vivo waren de prostaglandine E2, thromboxane B2 en leukotriene E4 de synthese verminderd na zeven dagen aan 75%, 65% en 45% van de aanvankelijke waarden, respectievelijk. In de huidige studie werden de gevolgen van nicotinezuur voor de lipoxygenase 5 weg in arachidonic zuurmetabolisme voor het eerst bestudeerd en de drug werd gevonden om deze weg te bevorderen in vitro en ex vivo. Het pyridoxine en het pyridoxal-5'-fosfaat in vitro hadden geen effect op de lipoxygenase 5 weg. De remming van leukotrienesynthese door zou pyridoxine ex vivo van therapeutisch belang kunnen zijn.

Omwenteling Med Liege. 1999 Jun; 54(6): 541-7.

[Homocysteine en cardiovasculair risico]

[Artikel in het Frans]

Lutteri L, Chapelle JP, Gielen J.

De dienst DE Chimie medicale, Universite DE Luik.

Homocystinuria is een ongewone genetische die ziekte door een duidelijke verhoging van serumhomocysteine wordt gekenmerkt (HCY), een tussenpersoon van methionine metabolisme. In patiënten met homocystinuria, bevordert hyperhomocysteinemia de ontwikkeling van atherosclerotic letsels en is de oorzaak van voorbarige kransslagaderziekte. Onlangs, hebben verscheidene studies ook dat gematigde hyperhomocysteinemia aangetoond--niet noodzakelijk verbonden met een ingeboren metabolisch tekort--kan ook als onafhankelijke risicofactor voor hart- en vaatziekte worden beschouwd. De belangrijkste mechanismen van de atherogenic actie van HCY worden verondersteld om LDL-oxydatie, remming van de vasculaire die endoteelgroei met stimulatie van vlotte spiercellenproliferatie wordt gecombineerd, en interferentie met de coagulatie en fibrinolytic systemen te zijn. De cofactoren van zeer belangrijke enzymen in HCY-metabolisme, folic zuur, vitamine B12 en vitamine B6, kunnen, alleen of in combinatie, voor de behandeling van hyperhomocysteinemia worden gegeven. Homocysteinemia kan door basisdieplasmahcy concentratie en/of door HCY niveaus worden beoordeeld na een methionine ladingstest worden gemeten. Hoofdzakelijk gemeten tot nu in gespecialiseerde laboratoria die eerder complexe technieken gebruiken (HPLC, GCMS, aminozuuranalisator…), HCY-spreidt de bepaling vandaag wijd ten gevolge van de ontwikkeling van geautomatiseerde immunoassays uit.

Dierenartsgezoem Toxicol. 1999 Jun; 41(3): 175-7.

Commentaar in: • Dierenartsgezoem Toxicol. 1999 Oct; 41(5): 342.

Beslagleggingen door theofylline en isoniazid in muizen worden veroorzaakt die.

Bonner ab, Peterson SL, Waterkeringsm.

Afdeling van Pediatrie, Scott & Witte Kliniek en Herdenkings het Ziekenhuis, van Scott, van Sherwood en Brindley-Stichting, het Centrum van Texas A&M University Health Science, Universiteit van Geneeskunde, Tempel 76502, de V.S.

De isoniazid-veroorzaakte beslagleggingen antwoorden slecht aan middelen tegen stuipen maar goed aan pyridoxine (Vitamine B6); de theofylline veroorzaakt moeilijk-aan-traktatiebeslagleggingen met wezenlijke morbiditeit en mortaliteit. De theofyllinetherapie drukt plasma pyridoxal-5'-fosfaat (PLP) in, actieve metabolite van pyridoxine voorstellen, die dat de theofylline-veroorzaakte beslagleggingen voor behandeling met pyridoxine ontvankelijk zouden kunnen zijn. Onze studie vestigde de dose-response verhouding voor uitbarstingen toe te schrijven aan isoniazid en theofylline in muizen en bepaalde als het pyridoxine dergelijke beslagleggingen tegenwerkte. Vrouwelijke gekruiste muizen cd-1 die 25 tot 30 g wegen werden gebruikt. De klonische beslagleggingen hadden klonische activiteit die 5 seconden duren; de tonische beslagleggingen hadden verlies van de het herstellen reflex met tonische hindlimbuitbreiding. De groepen van 10 muizen ontvingen enige dosissen 50, 100, 150, 200, 250 of 300 mg aminophylline/kg i.p. of 100, 150, 200, 250, 300 of 350 mg isoniazid/kg i.p. en werden waargenomen voor beslagleggingen of dood. Het pyridoxine of zout met aminophylline of isoniazid werd gelijktijdig beheerd. LD50 voor aminophylline was 266 mg/kg; voor isoniazid was het 160 mg/kg. De dosissen 150 mg aminophylline/kg of 100 mg isoniazid/kg veroorzaakten geen beslagleggingen. Het pyridoxine met aminophylline of isoniazid veranderde niet de frequentie of de tijd van begin van beslagleggingen of dood. Dit was onverwacht omdat het pyridoxine theofylline-veroorzaakte beslagleggingen in muizen tegenwerkt en isoniazid-veroorzaakte beslagleggingen in mensen omkeert. Wij vonden geen die bewijsmateriaal dat PLP-de uitputting in muizen een mechanisme voor beslagleggingen door isoniazid of aminophylline op een manier gelijkend op isoniazid in mensen worden veroorzaakt is.

BMJ. 1999 22 Mei; 318(7195): 1375-81.

Commentaar in: • De Club van ACS J. 1999 nov.-Dec; 131(3): 60. Doeltreffendheid van vitamine B-6 in de behandeling van premenstrueel syndroom: systematisch overzicht.

Wyatt km, Dimmock PW, Jones PW, Shaughn O'Brien-PM.

De academische Afdeling van Verloskunde en Gynaecologie, het Noord-Staffordshire Ziekenhuis, stookt op Trent ST4 6QG op.

DOELSTELLING: Om de doeltreffendheid van vitamine B-6 in de behandeling van premenstrueel syndroom te evalueren. ONTWERP: Het systematische overzicht van gepubliceerde en ongepubliceerde willekeurig verdeelde placebo controleerde proeven van de doeltreffendheid van vitamine B-6 in het beheer van premenstrueel syndroom. ONDERWERPEN: Negen gepubliceerde proeven die 940 patiënten met premenstrueel syndroom vertegenwoordigen. HOOFDresultatenmaatregelen: Aandeel vrouwen de van wie algemene premenstruele symptomen een verbetering over placebo toonden. Een secundaire analyse werd uitgevoerd op het aandeel vrouwen de van wie premenstruele depressieve symptomen een verbetering over placebo toonden. VLOEIT voort: De kansenverhouding met betrekking tot placebo voor een verbetering van algemene premenstruele symptomen was 2.32 (95% betrouwbaarheidsinterval 1.95 tot 2.54). De kansenverhouding met betrekking tot placebo voor een verbetering van depressieve symptomen was 1.69 (1.39 tot 2.06) van vier proeven die 541 patiënten vertegenwoordigen. CONCLUSIE: De conclusies worden beperkt door low quality van de meeste inbegrepen proeven. De resultaten stellen voor dat de dosissen vitamine B-6 tot 100 mg/dag waarschijnlijk van voordeel halen zullen zijn uit het behandelen van premenstruele symptomen en premenstruele depressie.

Int. J Vitam Nutr Onderzoek. 1999 Mei; 69(3): 187-93.

Het verminderen van homocysteine concentraties in bejaarden en vrouwen.

Bronstrup A, Hages M, Pietrzik K.

Afdeling van Pathofysiologie, Universiteit van Bonn, Duitsland.

De b-vitamine aanvulling is eerder getoond om de concentratie van plasma totale homocysteine, een risicofactor te verminderen voor hart- en vaatziekte. Weinig is gekend over de homocysteine-verminderende gevolgen van laag-dosis B-Vitaminen in bejaarde individuen, die op hogere homocysteine niveaus toe te schrijven aan geavanceerde leeftijd en een grotere frequentie van geschade vitaminestatus naar voren gebogen zijn. Wij poogden ons te identificeren als en in welke mate B-Vitaminen lagere totale homocysteine en zijn subfractions in bejaarde individuen. De mannen en de vrouwen (> of = 60 jaar) ontvingen of B-Vitaminen (400 microgrammen folic zuur + 1.65 mg pyridoxine + 3 microgrammen cyanocobalamin) of een placebo dagelijks 4 weken. De onderwerpen in de vitaminegroep toonden een significante daling van plasma totale homocysteine tijdens de eerste 2 weken; daarna, totale verminderde homocysteine slechts lichtjes verder het resulteren in een geometrisch gemiddeldevermindering van -16.3% (95% ci: -11.3% aan -21.0%) tijdens de volledige behandelingsperiode. Vrije ook verminderd homocysteine. Nochtans, stelt de waargenomen hogere verhouding van vrije/totale homocysteine na 4 weken van aanvulling een meer uitgesproken vermindering van protein-bound homocysteine voor. Laag-dosis de B-Vitamine aanvulling is efficiënt in het verminderen van homocysteine in bejaarde individuen. De verdere studies zijn nodig het effect kunnen afschilderen van B-Vitamine aanvulling op verschillende homocysteine sub-fractions in plasma.

Omwenteling Port Cardiol. 1999 Mei; 18(5): 507-14.

[Homocysteinemia en vaatziekte--een nieuwe risicofactor is geboren]

[Artikel in het Portugees]

Reis RP, Luis ZOALS.

Het ziekenhuis Pulido Valente, Faculdade DE Ciencias Medicas, Universidade Nova de Lisboa.

De laatste jaren is er groeiend bewijsmateriaal geweest dat de hoge niveaus van plasmatic homocysteine een onafhankelijke risicofactor voor vroege hart- en vaatziekte vormen. In dit artikel herzien wij de belangrijkste theorieën van atherosclerose die met de proteïnen rekening houden, namelijk homocysteine, homocysteine metabolisme, de oorzaak die van hoge niveaus van homocysteinemia kan de oorzaak zijn, de pathofysiologische mechanismen van vasculair die letsel door hyperhomocysteinemia, het klinische bewijsmateriaal worden veroorzaakt dat homocysteinemia een vasculaire risicofactor en tenslotte vormt, het bewijsmateriaal dat het mogelijk is om homocysteinemia met aanvulling van cofactoren van homocysteine metabolisme te controleren, namelijk vitamine B6, B12 of folic zuur.

Vopr Med Khim. 1999 mei-Jun; 45(3): 246-9.

[Effect van mexidol en zijn structurele componenten op koolhydraatniveau en lipideperoxidatie in scherpe spanning]

[Artikel in Rus]

Deviatkina Ta, Lutsenko rv, Vazhnichaia EM, Smirnov LD.

De Medische Stomatologische Academie van de Oekraïne, Poltava.

De invloed van mexidol (3-hydroxy-6-methyl-2-ethylpyridinesuccinate) en zijn structurele componenten (3-hydroxy-6-methyl-2-ethylpyridine en natriumsuccinate) werd en pyridoxinewaterstofchloride op koolhydraatinhoud en lipideperoxidatie bestudeerd in de muislever in de omstandigheden van spanning. Onder mexidol van spanningsvoorwaarden en pyridoxine uitgeoefende positieve gevolgen voor peroxidatieprocessen; mexidol normaliseerde ook glycogeeninhoud in de lever.

Am J Epidemiol. 1999 15 April; 149(8): 717-25.

Misselijkheid tijdens zwangerschap en aangeboren harttekorten: een geval-controle studie op basis van de bevolking.

Boneva RS, Moore CA, Botto L, Wong LY, Erickson JD.

Epidemische Inlichtingendienst, het Bureau van het Epidemiologieprogramma, Centra voor Ziektecontrole en Preventie, Atlanta, GA, de V.S.

De auteurs onderzochten de mogelijke vereniging tussen de misselijkheid van een moeder tijdens zwangerschap en het risico van haar kind voor een aangeboren harttekort gebruikend gegevens van de geval-Controle van de Geboortetekorten van Atlanta de Studie op basis van de bevolking die in 1982-1983 wordt uitgevoerd. De gevalzuigelingen (n = 998) hadden nonsyndromic aangeboren harttekorten en de controlezuigelingen (n = 3.029) hadden geen aangeboren tekorten. De misselijkheid tijdens zwangerschap (NP) werd in acht die niveaus van „strengheid gesorteerd“ op zijn begin, frequentie, en duur wordt gebaseerd. Niveau 1, strengste NP, werd geassocieerd met een lager risico voor een aangeboren die harttekort in het kind (kansenverhouding (OF) = 0.81, 95% betrouwbaarheidsinterval (ci) 0.67-0.99) zonder misselijkheid wordt vergeleken. Het lagere risico neigde om met minder strenge niveaus van misselijkheid te verdwijnen, en de tendens was statistisch significant. Algemene, vroege NP (niveaus 1 tot gecombineerde die 4) met gebruik van antinauseamedicijn, in het bijzonder Bendectin (doxylamine, dicyclomine (van de formulering in 1976 wordt gelaten vallen), pyridoxine (vitamine B6)), werd geassocieerd met een lager risico voor aangeboren harttekorten vergeleken met: 1) ontbreken van misselijkheid (OF = 0.67, 95% ci 0.50-0.92), en 2) misselijkheid zonder medicijngebruik (OF = 0.70, 95% ci 0.50-0.94). De resultaten stellen voor dat de zwangerschapshormonen en de factoren of, alternatief, een component van Bendectin (waarschijnlijkst pyridoxine) voor normale hartontwikkeling belangrijk kunnen zijn. Deze bevindingen schetsen potentiële gebieden voor toekomstig onderzoek naar en preventie van aangeboren harttekorten.

Ned Tijdschr Geneeskd. 1999 3 April; 143(14): 705-8.

[Obstetrische die problemen door slag worden gevolgd]

[Artikel in het Nederlands]

Lubbers MF, Aarnoudse JG, van Doormaal JJ.

Rijksuniversiteit, faculteit der Medische Wetenschappen, Groningen.

De obstetrische problemen voorspellen soms manifestaties van atherosclerose, zoals die door twee gevalrapporten worden geïllustreerd. De eerste patiënt had de combinatie van hyperhomocysteinaemia toe te schrijven aan chronische vitaminedeficiënties in het dieet, en het roken. De tweede was ook een roker en had een genetisch bepaalde milde die hyperhomocysteinaemia, door chronische vitaminedeficiënties wordt verergerd als gevolg van slechte dieetgewoonten; zij had ook een verhoogd folic zuur vereiste wegens gebruik van anti-epileptic drugs in combinatie met een familieneiging voor voorbarige atherosclerotic manifestaties. De eerste patiënt had vier zwangerschappen, twee waarvan in intrauterine foetale dood toe te schrijven aan placental infarct, en in de geboorte van een dysmature jongen beëindigden. De tweede vier zwangerschappen van de patiënt beëindigden tweemaal in abortus en tweemaal in de geboorte van een dysmature kind; in één van de laatstgenoemde gevallen werd placental infarct waargenomen. Beide vrouwen leden later aan hersenongevallen terwijl daarnaast, de oudere herseninfarcten om aanwezig werden gevonden te zijn. De vrouwen met terugkomende abortus, pre-eclampsia, placental infarct, placental detachement en foetale de groeivertraging moeten zouden worden onderzocht, zelfs als andere risicofactoren ook aanwezig, voor (milde) hyperhomocysteinaemia zijn, en behandeld voor het met vitaminesuppletion (folic zuur, vitaminen B6 en B12), zelfs hoewel algemeen bekend meer onderzoek noodzakelijk is om zich ervan te vergewissen dat dergelijke behandeling een preventief effect op de manifestaties van deze wanorde heeft.

Kan J Cardiol. 1999 April; 15 supplement B: 35B-38B.

Hyperhomocyst (e) inemia--bepalende factoren en behandeling.

Genestj Jr.

Klinisch Onderzoekinstituut van Montreal, Montreal, Canada. genesti@ircm.qc.ca

De opgeheven homocyst (e) ine niveaus worden geassocieerd met een verhoogd risico van vaatziekte, in het bijzonder aorto-iliac, coronaire en hersenziekte. In patiënten met bevestigde ziekte, is het plasma homocyst (e) ine een sterke voorspeller van dood. Naast B-vitaminen, folic zuur en bepaalde genotypen, is de nierfunctie een onafhankelijke determinant van plasma homocyst (e) ine niveau. Er kan ook een polygenic component zijn bijdragend tot opgeheven homocyst (e) ine niveaus in bevestigde vaatziekte. De mogelijke mechanismen van homocyst (e) ine-veroorzaakte vasculaire verandering omvatten proliferatie van vasculaire vlotte spiercellen, endothelial celdysfunctie en een procoagulant staat. De definitie van hyperhomocyst (e) inemia is gebaseerd op willekeurige besnoeiing-punten (b.v., 90ste percentile). In de meeste bevolking, is dit ongeveer 15 microM/L. De patiënten met hyperhomocyst (e) zouden inemia met minstens 400 microgrammen van folic zuur per dag moeten worden behandeld. De alternatieve behandelingen zijn vitamine B6 en B12 aanvulling, hoewel de optimale dosissen nog hebben worden geïdentificeerd.

Kan J Cardiol. 1999 April; 15 supplement B: 31B-34B.

Homocyst (e) ine, vitaminen en genetische interactie in vaatziekte.

Malinowm.

De Universiteit van de Gezondheidswetenschappen van Oregon, Portland, Oregon, de V.S. malinowr@ohsu.edu

De bloed homocyst (e) ine niveaus zijn een belangrijke, onafhankelijke en frequente risicofactor voor klinische atherosclerose en aderlijke trombose. Folic zuur, de vitaminen B6 en B12, de nier en schildklierfuncties, bepaalde medicijnen en bepaalde genotypen zijn gekend om plasma homocyst (e) ine niveaus te moduleren. De opname van B-vitaminen door dieet, aanvulling en versterkt voedsel vermindert homocyst (e) ine effectief concentratie en kan zo het risico van hart- en vaatziekte verminderen. Dit is waar zelfs in individuen die genetisch ontvankelijk gemaakt voor hyperhomocyst (e) inemia zijn. De willekeurig verdeelde klinische proeven zijn nodig om deze gevolgen verder te onderzoeken.

Clin Nutr. 1999 April; 18(2): 87-91.

De thiamine, riboflavine en pyridoxinestatus van patiënten op noodsituatietoelating aan het ziekenhuis.

Jamieson CP, Obeid OA, Powell-Tuck J.

Ministerie van Menselijke Voeding, St. Bartholomew en de Koninklijke School van Londen van Geneeskunde en Tandheelkunde, Londen, Whitechapel, E1 1BB, het UK.

Het doel van deze studie was het overwicht van thiamine, riboflavine en pyridoxinedeficiënties bij toelating aan het scherp ziekenhuis te beoordelen. Honderd twintig volwassen patiënten werden geselecteerd in het wilde weg uit die toegelaten via het Ongeval en de Noodsituatieafdeling meer dan 3 dagen. De vergelijkingen werden met een groep van 80 gezonde bloedgevers gemaakt die opeenvolgend een lokaal transfusiecentrum bijwonen. De alcoholopname van 500 die patiënten opeenvolgend via hetzelfde Ongeval en de Noodsituatieafdeling worden toegelaten werd ook beoordeeld. Erytrociettransketolase (ETK), glutathione reductase (EGR) en aspartate aminotransferase (EAA) werden coenzyme activeringsanalyses gebruikt om thiamine, riboflavine en pyridoxinedeficiënties te bepalen. Prevalences van deficiëntiestaten in de intern verpleegde patiëntgroep waren 21, 2.7 en 32% voor thiamine, riboflavine en pyridoxinedeficiënties respectievelijk met 49.2% zijnd ontoereikend in één of meerdere vitamine. De gemiddelde alcoholopname in de groep patiënten in wie dit werd beoordeeld was 9.7 die eenheden per week met 10 eenheden per week onder bloedgevers worden vergeleken. Copyright 1999 Harcourt Publishers Ltd.

Epidemiol Mikrobiol Imunol. 1999 April; 48(2): 71-5.

[Bepaling van de virussen van het tabaksmozaïek en teercarcinogenen die elektromagnetische resonantie in rokers gebruiken]

[Artikel in Tsjech]

Bradna J.

Nemocnices ambulanci, Kutna Hora.

Afstand het toezicht op virale ziekten in de streek van Mhz-frequenties maakt snel niet-contactonderzoek van de aanwezigheid van de virussen van het tabaksmozaïek (VTM) in sigaretten en afscheidingen van rokers mogelijk door elektromagnetische resonantie te gebruiken. De weerslag van VTM in gemeenschappelijke sigaretten werd beoordeeld evenals in verscheidene rokers, in dermatitis, arthralgias en in tumors (van grote intestiner, in mastopathy). Ook in neuritis van de optische zenuw, in veronderstelde sclerose samengesteld van rokers. Na sanation van VTM door resonantietherapie met Sanator (Bradna AO 272.361) VTM verdween evenals symptomen van deze virale mozaïekziekte. De elektromagnetische resonantie met teer maakte het mogelijk om dit onderzoek in sigarettenfilters na het roken evenals in de afscheidingen van rokers te maken. De auteurs bewezen het verhaastende effect van sigaretrook met teer op de groei van VTM bij de cultuur evenals een verhoging van de bioelectric activiteit van tumors. Het bleek mogelijk om de elektromagnetische afstandsactie van teer door interactie met pyridsoxine zoals in voedsel zo ook af te schaffen bevat teer (gerookt vlees, vissen, frankfurterworsten, zwarte koffie, cacao). Filters met pyridoxine bewezen nuttig. VTM-controle was snel, in tumors was het mogelijk om de begeleidende virale agent evenals de actie van cancerogens op hun bioelectromagnetic activiteit te volgen. Het maakte het mogelijk ook om het desintegreren actie van Mhz-resonantiefrequenties van Sanator op te volgen.

J Am Coll Nutr. 1999 April; 18(2): 144-51. De invloed van dieetbeperking op vitamine B-6 vitamer distributie en op vitamine B-6 die enzymen bij ratten metaboliseren.

Wei IL.

Laboratorium van Voeding, School van Verzorging, Nationaal Yang-Ming University, Taipeh, Taiwan.

DOELSTELLING: Het doel van deze studie was het effect te beoordelen van dieetbeperking bij de weefseldistributie van vitamine B-6 vitamers en activiteiten van vitamine B-6 metaboliserend enzymen bij ratten. METHODES: De mannelijke ratten werden onderworpen aan een 40% dieetbeperking 10, 20 of 40 weken. Weefselvitamine B-6 werd vitamer concentraties en activiteiten van vitamine B-6 die enzymen van de dieren metaboliseren bepaald. VLOEIT voort: Plasmapyridoxal 5 ' - de fosfaat (PLP) concentraties van de dieet-beperkte (DR.) ratten waren vergelijkbaar met die van de controlegroep bij week tien maar waren beduidend lager bij weken 20 en 40. Deze beduidend lagere niveaus van plasma PLP in DR. ratten zouden voor een deel op lagere leverpyridoxal kinase en pyridoxamine (pyridoxine) 5 ' kunnen worden betrekking gehad - phosphate oxydaseactiviteiten. Urine pyridoxic zure afscheiding 4 van DR. groepen antwoordde aan de verminderde voedselopname en was lager bij weken 10 en 20. De weefselniveaus van PLP werden niet beïnvloed door dieetbeperking. In tegenstelling, hogere niveaus van pyridoxamine 5 ' - het fosfaat werd gevonden in lever, nier en hart van DR. dieren. CONCLUSIE: De duur van dieetbeperking beïnvloedde de distributie van vitamine B-6 vitamers. Wanneer het plasma PLP wordt gebruikt om vitamine B-6 te evalueren status, zou de lengte van dieetbeperking moeten worden overwogen.

J Am Soc Nephrol. 1999 April; 10(4): 840-5. Opname van vitaminen B6 en C en het risico van nierstenen in vrouwen.

Curhangc, Willett-WC, FE Speizer, Stampfer MJ.

Channing Laboratory, Afdeling van Geneeskunde, Brigham en het Ziekenhuis van Vrouwen, de Medische School van Harvard, Boston, Massachusetts 02115, de V.S. gary.curhan@channing.harvard.edu

Het urineoxalaat is een belangrijke determinant van de niersteenvorming van het calciumoxalaat. De hoge dosissen vitamine B6 kunnen oxalaatproductie verminderen, terwijl de vitamine C aan oxalaat kan worden gemetaboliseerd. Deze studie werd uitgevoerd om de vereniging tussen de opnamen van vitaminen B6 en C en risico van niersteenvorming in vrouwen te onderzoeken. De relatie tussen de opname van vitaminen B6 en C en het risico van symptomatische nierstenen werd voor de toekomst bestudeerd in een cohort van 85.557 vrouwen zonder geschiedenis van nierstenen. Semi-kwantitatieve werden de voedsel-frequentie vragenlijsten gebruikt om vitamineconsumptie van zowel voedsel als supplementen te beoordelen. Een totaal van 1078 inherente gevallen van nierstenen werden gedocumenteerd tijdens de 14 jaar follow-upperiode. Een hoge opname van vitamine B6 werd omgekeerd geassocieerd met risico van steenvorming. Na het aanpassen andere dieetfactoren, was het relatieve risico van inherente steenvorming voor vrouwen in de hoogste die categorie van B6 opname (> of =40 mg/d) met de laagste categorie (<3 mg/d) wordt vergeleken 0.66 (95% betrouwbaarheidsinterval, 0.44 tot 0.98). In tegenstelling, werd de vitamine Copname niet geassocieerd met risico. Het multivariate relatieve risico voor vrouwen in de hoogste die categorie van vitamine Copname (> of =1500 mg/d) met de laagste categorie (<250 mg/d) wordt vergeleken was 1.06 (95% betrouwbaarheidsinterval, 0.69 tot 1.64). De grote dosissen vitamine B6 kunnen het risico van niersteenvorming in vrouwen verminderen. De routinebeperking van vitamine C om steenvorming te verhinderen lijkt ongerechtvaardigd.